SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI335892 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI335892
Domain Number 1 Region: 298-343
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000157
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI335892
Sequence length 502
Comment (Laccaria bicolor)
Sequence
MPDNTRDEAPATGGRRSSRLMPLPGSRGAPNFDKEKPIELLRFIDQMEDLFTEHGIDDDQ
EKKKQLGRYTDQMTEFEWRAFDMFAPEIEYKEFKQALIDDYPEAKNAGKGTLANLRKICN
DHQRIDIDNIVALKSLTRGFRAEQKLLLVPPALVSNRELVELFLGCLRDSFRGQVEGSLN
IKLSQDKGKAVDGKERRPEDPYAILDVIEMAETIAGRAQGISSSSDTQVGVNATETWTTR
GHHTHTTPVHSVKLEDDIRELNQKVALLMDKITSSEKAQMSAFQASRQEMNKLTEMLMTQ
HVTSAPTMRQTQPTWRMGSDGCWYCEETGHFAMNCPHREEHIRTGKIKMSGHKMFFALTG
QPVPRGTNGKSAKMIVEEASNKDMMAQSNMFASPGEIYTQNSGEPGIVQLGIDARVKSVY
TNQIRDLRDDMLDKMATRIDTLLGNKVPAQVARPLAQEVDIVNNMKNILSYFEGQQGQGQ
EAASYVATRRSQADTQEQQGFS
Download sequence
Identical sequences B0E3R6
29883.JGI335892 XP_001890834.1.58555 jgi|Lacbi1|335892|fgenesh3_pg.C_scaffold_177000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]