SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI336012 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI336012
Domain Number 1 Region: 213-258
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000968
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI336012
Sequence length 352
Comment (Laccaria bicolor)
Sequence
MPDNTQDEAPATGGRRSSRPMPLPGSRGAPNFDKEKPIELLRFIDQMEDLFTEHGIDDDQ
EKKKQLGRYTDQKTEFEWQAFDMFAPEVEYKEFKQVLIDDYPEAKMAGKGRLANLRKICK
DHQHIDIDDFIALKNLTRSFRAEQKLLLTPPALDVHKGLALQVIPGVKLEDDIRELNQKF
ALLMDKITSSEKAQMSAFQASRQEMNKLTETLMTQHVTSAPTMRQTQPTWRMGSDGCWYC
EETGHFAMNCPHREEHIRTGKIKMSGHKMFFALTGQPVPRGTNGKSAKMIVEEASNKDMM
AQSNMFASPGEIYTQNSGEPGIVQLGIDARVKSVYTNQIRDSRDDLLDKMAT
Download sequence
Identical sequences B0E454
jgi|Lacbi1|336012|fgenesh3_pg.C_scaffold_233000001 XP_001890972.1.58555 29883.JGI336012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]