SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI336344 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29883.JGI336344
Domain Number - Region: 162-183
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0366
Family Retrovirus zinc finger-like domains 0.0091
Further Details:      
 
Domain Number - Region: 130-164
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.047
Family Canonical RBD 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI336344
Sequence length 261
Comment (Laccaria bicolor)
Sequence
MSRRILLPAPKPLSYVQTRCMCTFSLLNRLQRRPFNGKIAKIGFYTVEHVSPVSTANAEA
FLQELGETEASFKTRSFNVVAYYVPLNLDANSEKDRGEIEEMNNIPKGALTKLRWIKPPA
RRRPDQRFAHVIATFSDAESANRAIVNGLSICHKRVSVAKCKKEPIRCLKCQGWDHIALE
CIIAKEVNVCAQDVTYSAEYHRLRFMLIWYNQAHRKTGTGKLNWVSSPRPQVEDQSPIAP
PASSNGSPPPDSSTTQVIAHV
Download sequence
Identical sequences B0E563
29883.JGI336344 XP_001891331.1.58555 jgi|Lacbi1|336344|fgenesh3_pg.C_scaffold_757000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]