SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 300267.SDY_0411 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  300267.SDY_0411
Domain Number 1 Region: 96-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000785
Family NfeD domain-like 0.0089
Further Details:      
 
Weak hits

Sequence:  300267.SDY_0411
Domain Number - Region: 32-81
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000589
Family LacY-like proton/sugar symporter 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 300267.SDY_0411
Sequence length 152
Comment (Shigella dysenteriae)
Sequence
MMELIVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLVVWLVPLGWEWQGVMF
AVLTLLAAWLWWKWLSRRVREQKHSNSHLNQRGQQLIGRRFVLESPLVNGRGHMRVGDSS
WPVSASEDLGAGTHVEVIAIEGITLIIRAVIA
Download sequence
Identical sequences A0A090NN76 A0A0A6ZP68 Q32J85
300267.SDY_0411 gi|560155253|ref|YP_008847968.1| WP_000970312.1.35349 WP_000970312.1.50304 YP_402111.1.10455 gi|82775764|ref|YP_402111.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]