SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 300268.SBO_2669 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  300268.SBO_2669
Domain Number 1 Region: 138-415
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 5.63e-84
Family D-glucarate dehydratase-like 0.00000000403
Further Details:      
 
Domain Number 2 Region: 7-136
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.53e-32
Family Enolase N-terminal domain-like 0.0000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 300268.SBO_2669
Sequence length 446
Comment (Shigella boydii Sb227)
Sequence
MTTQSSPVITDMKVIPVAGHDSMLLNIGGAHNAYFTRNIVVLTDNAGHTGIGEAPGGEVI
YQTLVDAIPMVLGQEVARLNKVVQQVHKGNQAADFDTFGKGAWTFELHVNAVAALEAALL
DLLGKALNVPVCELLGPGKQRETITVLGYLFYIGDRTKTDLPYLENTPGNHEWYQLRHQK
AMNSEAVVRLAEASQDRYGFKDFKLKGGVLPGEQEIDTVRALKKRFPDARITVDPNGAWL
LDEAISLCKGLNDVLTYAEDPCGAEQGFSGREVMAEFRRATGLPVATNMIATNWREMGHA
VMLNAVDIPLADPHFWTLSGAVRVAQLCDDWGLTWGCHSNNHFDISLAMFTHVGAAAPGN
PTAIDTHWIWQEGDCRLTKNPLEIKNGKIAVPDAPGLGVELDWEQVQKAHEAYKRLPGGA
RNDAGPMQYLIPGWTFDRKRPVFGRH
Download sequence
Identical sequences A0A2K0Q0D9 E7THX8 I6DTA6 Q31XK2
300268.SBO_2669 gi|82545087|ref|YP_409034.1| WP_000211745.1.100447 WP_000211745.1.11296 WP_000211745.1.13144 WP_000211745.1.13798 WP_000211745.1.14253 WP_000211745.1.15768 WP_000211745.1.16862 WP_000211745.1.17734 WP_000211745.1.18225 WP_000211745.1.19651 WP_000211745.1.21024 WP_000211745.1.2325 WP_000211745.1.26125 WP_000211745.1.27426 WP_000211745.1.28046 WP_000211745.1.35039 WP_000211745.1.44452 WP_000211745.1.44840 WP_000211745.1.45538 WP_000211745.1.55185 WP_000211745.1.55870 WP_000211745.1.57349 WP_000211745.1.65056 WP_000211745.1.68067 WP_000211745.1.68271 WP_000211745.1.86717 WP_000211745.1.88557 WP_000211745.1.93150 WP_000211745.1.97502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]