SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 300269.SSON_1747 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  300269.SSON_1747
Domain Number 1 Region: 794-1166
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.14e-118
Family PFOR PP module 0.0000000338
Further Details:      
 
Domain Number 2 Region: 419-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.57e-76
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000128
Further Details:      
 
Domain Number 3 Region: 2-254
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.68e-71
Family PFOR Pyr module 0.0000000952
Further Details:      
 
Domain Number 4 Region: 256-411
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 5e-43
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000197
Further Details:      
 
Domain Number 5 Region: 665-838
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 6.7e-23
Family Ferredoxin domains from multidomain proteins 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 300269.SSON_1747
Sequence length 1174
Comment (Shigella sonnei Ss046)
Sequence
MITIDGNGAVASVAFRTSEVIAIYPITPSSTMAEQADAWAGNGLKNVWGDTPCVVEMQSE
AGAIATVHGALQTGALSTSFTSSQGLLLMIPTLYKLAGELTPFVLHVAARTVATHALSIF
GDHSDVMAVRQTGCAMLCAANVQEAQDFALISHIATLKSRVPFIHFFDGFRTSHEINKIV
PLADDTILDLMPQAEIDAHRARALNPEHPVIRGTSANPDTYFQSREATNPWYNAVYDHVE
QAMNDFSAATGRQYQPFEYYGHPQAERVIILMGSAIGTCEEVVDELLTRGEKVGVLKVRL
YRPFSAKHLLQTLPGSVRSVAVLDRTKEPGAQAEPLYLDVMTALAEAFNNGKRETLPRVI
GGRYGLSSKEFGPDCVLAVFAELNAAKPKARFTVGIYDDVTNLSLPLPENTQPNSAKLEA
LFYGLGSDGSVSATKNNIKIIGNSTPWYAQGYFVYDSKKAGGLTVSHLRVSEQPIRSAYL
ISQADFVGCHQLQFIDKYQMAERLKPGGIFLLNTPYSADEVWSRLPQEVQAVLNQKKARF
YVINAAKIARKCGLAARINTVMQMAFFHLTQILPGDSALAELQGAIAKSYSSKGQDLVER
NWQALALARESVEEVPLQPVNPHSANRPPVVSDAAPDFVKTVTAAMLAGLGDALPVSALP
PDGTWPMGTTRWEKRNIAEEIPIWKEELCTQCNHCVAACPHSAIRAKVVPPEAMENAPAS
LHSLDVKSRDMRGQKYVLQVAPEDCTGCNLCVEVCPAKDRQNPEIKAINMMSRLEHVEEE
KINYDFFLNLPEIDRSKLERIDIRTSQLITPLFEYSGACSGCGETPYIKLLTQLYGDRML
IANATGCSSIYGGNLPSTPYTTDANGRGPAWANSLFEDNAEFGLGFRLTVDQHRVRVLRL
LDQFADKIPAELLTALKSDATPEVRREQVAALRQQLNDVAEAHELLRDADALVEKSIWLI
GGDGWAYDIGFGGLDHVLSLTENVNILVLDTQCYSNTGGQASKATPLGAVTKFGEHGKRK
ARKDLGVSMMMYGHVYVAQISLGAQLNQTVKAIQEAEAYPGPSLIIAYSPCEEHGYDLAL
SHDQMRQLTATGFWPLYRFDPRRADEGKLPLALDSRPPSEALEETLLHEQRFRRLNSQQP
EVAEQLWKDAAADLQKRYDFLAQMAGKAEKSNTD
Download sequence
Identical sequences A0A0I3K6F5 Q3Z1C8
gi|74312250|ref|YP_310669.1| gi|383178580|ref|YP_005456585.1| 300269.SSON_1747 WP_000628142.1.100063 WP_000628142.1.100135 WP_000628142.1.100315 WP_000628142.1.100389 WP_000628142.1.100448 WP_000628142.1.10048 WP_000628142.1.100725 WP_000628142.1.100851 WP_000628142.1.100852 WP_000628142.1.101121 WP_000628142.1.101175 WP_000628142.1.101214 WP_000628142.1.101313 WP_000628142.1.101594 WP_000628142.1.101887 WP_000628142.1.101889 WP_000628142.1.101937 WP_000628142.1.101940 WP_000628142.1.101942 WP_000628142.1.102021 WP_000628142.1.102093 WP_000628142.1.10222 WP_000628142.1.10329 WP_000628142.1.10348 WP_000628142.1.10352 WP_000628142.1.10508 WP_000628142.1.10525 WP_000628142.1.10576 WP_000628142.1.10628 WP_000628142.1.10715 WP_000628142.1.10771 WP_000628142.1.10862 WP_000628142.1.10995 WP_000628142.1.11251 WP_000628142.1.11272 WP_000628142.1.11323 WP_000628142.1.11440 WP_000628142.1.11452 WP_000628142.1.11499 WP_000628142.1.11595 WP_000628142.1.11673 WP_000628142.1.1176 WP_000628142.1.11762 WP_000628142.1.12000 WP_000628142.1.12112 WP_000628142.1.1218 WP_000628142.1.12204 WP_000628142.1.12292 WP_000628142.1.12426 WP_000628142.1.1280 WP_000628142.1.13346 WP_000628142.1.13383 WP_000628142.1.13411 WP_000628142.1.13566 WP_000628142.1.13589 WP_000628142.1.13740 WP_000628142.1.13891 WP_000628142.1.13981 WP_000628142.1.14094 WP_000628142.1.14127 WP_000628142.1.14299 WP_000628142.1.14451 WP_000628142.1.14499 WP_000628142.1.14711 WP_000628142.1.1486 WP_000628142.1.14861 WP_000628142.1.14958 WP_000628142.1.14965 WP_000628142.1.15007 WP_000628142.1.15148 WP_000628142.1.15191 WP_000628142.1.15245 WP_000628142.1.15252 WP_000628142.1.15287 WP_000628142.1.15565 WP_000628142.1.15762 WP_000628142.1.15771 WP_000628142.1.1580 WP_000628142.1.15894 WP_000628142.1.16015 WP_000628142.1.16188 WP_000628142.1.16303 WP_000628142.1.16482 WP_000628142.1.16604 WP_000628142.1.16640 WP_000628142.1.16669 WP_000628142.1.16894 WP_000628142.1.16970 WP_000628142.1.17085 WP_000628142.1.17089 WP_000628142.1.17186 WP_000628142.1.17205 WP_000628142.1.17230 WP_000628142.1.1726 WP_000628142.1.17300 WP_000628142.1.17301 WP_000628142.1.17389 WP_000628142.1.17441 WP_000628142.1.17570 WP_000628142.1.17765 WP_000628142.1.1778 WP_000628142.1.17836 WP_000628142.1.18311 WP_000628142.1.18354 WP_000628142.1.18583 WP_000628142.1.18628 WP_000628142.1.18675 WP_000628142.1.18806 WP_000628142.1.1903 WP_000628142.1.19113 WP_000628142.1.19122 WP_000628142.1.1915 WP_000628142.1.19315 WP_000628142.1.19487 WP_000628142.1.19602 WP_000628142.1.19758 WP_000628142.1.19838 WP_000628142.1.19845 WP_000628142.1.19873 WP_000628142.1.19945 WP_000628142.1.20025 WP_000628142.1.20096 WP_000628142.1.20178 WP_000628142.1.20192 WP_000628142.1.2022 WP_000628142.1.20230 WP_000628142.1.20290 WP_000628142.1.20370 WP_000628142.1.20636 WP_000628142.1.20668 WP_000628142.1.20831 WP_000628142.1.2093 WP_000628142.1.21022 WP_000628142.1.21059 WP_000628142.1.21129 WP_000628142.1.2113 WP_000628142.1.21131 WP_000628142.1.21197 WP_000628142.1.21277 WP_000628142.1.21578 WP_000628142.1.21637 WP_000628142.1.21673 WP_000628142.1.21762 WP_000628142.1.21811 WP_000628142.1.22268 WP_000628142.1.22295 WP_000628142.1.22470 WP_000628142.1.22501 WP_000628142.1.22571 WP_000628142.1.22641 WP_000628142.1.22809 WP_000628142.1.22827 WP_000628142.1.22846 WP_000628142.1.22961 WP_000628142.1.22990 WP_000628142.1.23062 WP_000628142.1.23081 WP_000628142.1.23257 WP_000628142.1.23270 WP_000628142.1.23293 WP_000628142.1.23352 WP_000628142.1.23443 WP_000628142.1.23456 WP_000628142.1.2353 WP_000628142.1.23554 WP_000628142.1.23561 WP_000628142.1.23563 WP_000628142.1.23584 WP_000628142.1.23660 WP_000628142.1.23729 WP_000628142.1.23795 WP_000628142.1.23881 WP_000628142.1.23914 WP_000628142.1.23931 WP_000628142.1.24 WP_000628142.1.24051 WP_000628142.1.24120 WP_000628142.1.24194 WP_000628142.1.24290 WP_000628142.1.2437 WP_000628142.1.24533 WP_000628142.1.2456 WP_000628142.1.24560 WP_000628142.1.24570 WP_000628142.1.24791 WP_000628142.1.24799 WP_000628142.1.24981 WP_000628142.1.24982 WP_000628142.1.25060 WP_000628142.1.25289 WP_000628142.1.25346 WP_000628142.1.2537 WP_000628142.1.254 WP_000628142.1.25403 WP_000628142.1.255 WP_000628142.1.25517 WP_000628142.1.25598 WP_000628142.1.25602 WP_000628142.1.25652 WP_000628142.1.25717 WP_000628142.1.25718 WP_000628142.1.25855 WP_000628142.1.25915 WP_000628142.1.2612 WP_000628142.1.26135 WP_000628142.1.26467 WP_000628142.1.26570 WP_000628142.1.26575 WP_000628142.1.26766 WP_000628142.1.27105 WP_000628142.1.27683 WP_000628142.1.27786 WP_000628142.1.28168 WP_000628142.1.28414 WP_000628142.1.28433 WP_000628142.1.28440 WP_000628142.1.28762 WP_000628142.1.28769 WP_000628142.1.28791 WP_000628142.1.28835 WP_000628142.1.29146 WP_000628142.1.29197 WP_000628142.1.29252 WP_000628142.1.29556 WP_000628142.1.29699 WP_000628142.1.29740 WP_000628142.1.2986 WP_000628142.1.29933 WP_000628142.1.30141 WP_000628142.1.30221 WP_000628142.1.30401 WP_000628142.1.30580 WP_000628142.1.3063 WP_000628142.1.30700 WP_000628142.1.30960 WP_000628142.1.31026 WP_000628142.1.31353 WP_000628142.1.31434 WP_000628142.1.31482 WP_000628142.1.31527 WP_000628142.1.31625 WP_000628142.1.31639 WP_000628142.1.31679 WP_000628142.1.31736 WP_000628142.1.31801 WP_000628142.1.31899 WP_000628142.1.31903 WP_000628142.1.31937 WP_000628142.1.32049 WP_000628142.1.32078 WP_000628142.1.32242 WP_000628142.1.32279 WP_000628142.1.32333 WP_000628142.1.32435 WP_000628142.1.32635 WP_000628142.1.327 WP_000628142.1.32715 WP_000628142.1.32720 WP_000628142.1.32741 WP_000628142.1.33053 WP_000628142.1.33171 WP_000628142.1.3323 WP_000628142.1.33237 WP_000628142.1.33362 WP_000628142.1.33413 WP_000628142.1.33561 WP_000628142.1.33729 WP_000628142.1.33979 WP_000628142.1.3415 WP_000628142.1.34380 WP_000628142.1.34440 WP_000628142.1.34541 WP_000628142.1.34557 WP_000628142.1.34655 WP_000628142.1.34668 WP_000628142.1.34827 WP_000628142.1.34983 WP_000628142.1.35186 WP_000628142.1.35398 WP_000628142.1.35654 WP_000628142.1.36040 WP_000628142.1.36159 WP_000628142.1.36281 WP_000628142.1.36299 WP_000628142.1.36537 WP_000628142.1.36971 WP_000628142.1.37006 WP_000628142.1.37076 WP_000628142.1.37101 WP_000628142.1.37146 WP_000628142.1.3749 WP_000628142.1.37543 WP_000628142.1.37940 WP_000628142.1.38264 WP_000628142.1.38419 WP_000628142.1.39015 WP_000628142.1.3903 WP_000628142.1.39111 WP_000628142.1.39155 WP_000628142.1.39157 WP_000628142.1.39373 WP_000628142.1.39468 WP_000628142.1.39580 WP_000628142.1.39715 WP_000628142.1.39730 WP_000628142.1.40121 WP_000628142.1.40159 WP_000628142.1.40183 WP_000628142.1.40623 WP_000628142.1.4081 WP_000628142.1.41230 WP_000628142.1.41259 WP_000628142.1.41606 WP_000628142.1.41718 WP_000628142.1.41778 WP_000628142.1.42095 WP_000628142.1.42096 WP_000628142.1.42300 WP_000628142.1.42359 WP_000628142.1.42369 WP_000628142.1.42728 WP_000628142.1.42750 WP_000628142.1.42791 WP_000628142.1.42828 WP_000628142.1.42830 WP_000628142.1.42966 WP_000628142.1.43324 WP_000628142.1.43374 WP_000628142.1.43566 WP_000628142.1.4400 WP_000628142.1.4411 WP_000628142.1.44264 WP_000628142.1.44287 WP_000628142.1.44314 WP_000628142.1.44424 WP_000628142.1.44426 WP_000628142.1.44539 WP_000628142.1.44686 WP_000628142.1.448 WP_000628142.1.44814 WP_000628142.1.44818 WP_000628142.1.44848 WP_000628142.1.45156 WP_000628142.1.4524 WP_000628142.1.45494 WP_000628142.1.45500 WP_000628142.1.4563 WP_000628142.1.45962 WP_000628142.1.45991 WP_000628142.1.4617 WP_000628142.1.46245 WP_000628142.1.46468 WP_000628142.1.46655 WP_000628142.1.46734 WP_000628142.1.46857 WP_000628142.1.47030 WP_000628142.1.47316 WP_000628142.1.47350 WP_000628142.1.47416 WP_000628142.1.47451 WP_000628142.1.47582 WP_000628142.1.4773 WP_000628142.1.47914 WP_000628142.1.47983 WP_000628142.1.48285 WP_000628142.1.48404 WP_000628142.1.48417 WP_000628142.1.48590 WP_000628142.1.48825 WP_000628142.1.48907 WP_000628142.1.49136 WP_000628142.1.49259 WP_000628142.1.49431 WP_000628142.1.49528 WP_000628142.1.49684 WP_000628142.1.49777 WP_000628142.1.49902 WP_000628142.1.50098 WP_000628142.1.50136 WP_000628142.1.50196 WP_000628142.1.50230 WP_000628142.1.50273 WP_000628142.1.50329 WP_000628142.1.50381 WP_000628142.1.5040 WP_000628142.1.5041 WP_000628142.1.5046 WP_000628142.1.50548 WP_000628142.1.506 WP_000628142.1.50936 WP_000628142.1.50993 WP_000628142.1.51127 WP_000628142.1.51201 WP_000628142.1.51336 WP_000628142.1.51354 WP_000628142.1.51364 WP_000628142.1.51503 WP_000628142.1.51513 WP_000628142.1.51624 WP_000628142.1.51662 WP_000628142.1.51869 WP_000628142.1.51906 WP_000628142.1.52011 WP_000628142.1.52111 WP_000628142.1.52126 WP_000628142.1.52230 WP_000628142.1.52236 WP_000628142.1.52240 WP_000628142.1.52304 WP_000628142.1.52328 WP_000628142.1.52413 WP_000628142.1.52554 WP_000628142.1.52567 WP_000628142.1.52601 WP_000628142.1.52755 WP_000628142.1.52942 WP_000628142.1.52996 WP_000628142.1.53099 WP_000628142.1.53186 WP_000628142.1.53277 WP_000628142.1.53308 WP_000628142.1.53419 WP_000628142.1.53431 WP_000628142.1.5351 WP_000628142.1.53535 WP_000628142.1.53574 WP_000628142.1.53811 WP_000628142.1.53878 WP_000628142.1.5395 WP_000628142.1.53968 WP_000628142.1.5433 WP_000628142.1.5440 WP_000628142.1.54614 WP_000628142.1.54641 WP_000628142.1.54921 WP_000628142.1.54946 WP_000628142.1.55177 WP_000628142.1.55482 WP_000628142.1.55483 WP_000628142.1.55581 WP_000628142.1.5566 WP_000628142.1.55727 WP_000628142.1.55979 WP_000628142.1.56101 WP_000628142.1.56345 WP_000628142.1.56388 WP_000628142.1.56446 WP_000628142.1.5649 WP_000628142.1.56573 WP_000628142.1.56713 WP_000628142.1.56777 WP_000628142.1.56787 WP_000628142.1.56908 WP_000628142.1.56937 WP_000628142.1.56951 WP_000628142.1.56992 WP_000628142.1.57269 WP_000628142.1.57319 WP_000628142.1.57574 WP_000628142.1.57588 WP_000628142.1.57628 WP_000628142.1.57634 WP_000628142.1.57663 WP_000628142.1.57898 WP_000628142.1.57903 WP_000628142.1.57951 WP_000628142.1.57975 WP_000628142.1.5812 WP_000628142.1.58368 WP_000628142.1.58680 WP_000628142.1.58942 WP_000628142.1.59218 WP_000628142.1.59396 WP_000628142.1.59689 WP_000628142.1.597 WP_000628142.1.59855 WP_000628142.1.5990 WP_000628142.1.59914 WP_000628142.1.60186 WP_000628142.1.60246 WP_000628142.1.60443 WP_000628142.1.60559 WP_000628142.1.60570 WP_000628142.1.60599 WP_000628142.1.60614 WP_000628142.1.60644 WP_000628142.1.60671 WP_000628142.1.60684 WP_000628142.1.60771 WP_000628142.1.60816 WP_000628142.1.60826 WP_000628142.1.60847 WP_000628142.1.60921 WP_000628142.1.60974 WP_000628142.1.61148 WP_000628142.1.61223 WP_000628142.1.61268 WP_000628142.1.61362 WP_000628142.1.61373 WP_000628142.1.61496 WP_000628142.1.61524 WP_000628142.1.61612 WP_000628142.1.61643 WP_000628142.1.61703 WP_000628142.1.61718 WP_000628142.1.61853 WP_000628142.1.61893 WP_000628142.1.61966 WP_000628142.1.62303 WP_000628142.1.62348 WP_000628142.1.6245 WP_000628142.1.62507 WP_000628142.1.62513 WP_000628142.1.62802 WP_000628142.1.62992 WP_000628142.1.63023 WP_000628142.1.6334 WP_000628142.1.63602 WP_000628142.1.63683 WP_000628142.1.63800 WP_000628142.1.63871 WP_000628142.1.63990 WP_000628142.1.64280 WP_000628142.1.64437 WP_000628142.1.64540 WP_000628142.1.64563 WP_000628142.1.64634 WP_000628142.1.6469 WP_000628142.1.64821 WP_000628142.1.64895 WP_000628142.1.64939 WP_000628142.1.65110 WP_000628142.1.65135 WP_000628142.1.6516 WP_000628142.1.65192 WP_000628142.1.65296 WP_000628142.1.6553 WP_000628142.1.65667 WP_000628142.1.65677 WP_000628142.1.65714 WP_000628142.1.65954 WP_000628142.1.66102 WP_000628142.1.6622 WP_000628142.1.66264 WP_000628142.1.66335 WP_000628142.1.66432 WP_000628142.1.66791 WP_000628142.1.66975 WP_000628142.1.67149 WP_000628142.1.67462 WP_000628142.1.67467 WP_000628142.1.67704 WP_000628142.1.67901 WP_000628142.1.67938 WP_000628142.1.67984 WP_000628142.1.68053 WP_000628142.1.68069 WP_000628142.1.68108 WP_000628142.1.68126 WP_000628142.1.68145 WP_000628142.1.68281 WP_000628142.1.68369 WP_000628142.1.68482 WP_000628142.1.68490 WP_000628142.1.68584 WP_000628142.1.68598 WP_000628142.1.68630 WP_000628142.1.68635 WP_000628142.1.68752 WP_000628142.1.68961 WP_000628142.1.69039 WP_000628142.1.6919 WP_000628142.1.69192 WP_000628142.1.6929 WP_000628142.1.69441 WP_000628142.1.69537 WP_000628142.1.69596 WP_000628142.1.69730 WP_000628142.1.69979 WP_000628142.1.70190 WP_000628142.1.70256 WP_000628142.1.70509 WP_000628142.1.70530 WP_000628142.1.70600 WP_000628142.1.70656 WP_000628142.1.70698 WP_000628142.1.70728 WP_000628142.1.70747 WP_000628142.1.71037 WP_000628142.1.71170 WP_000628142.1.71176 WP_000628142.1.71223 WP_000628142.1.7147 WP_000628142.1.71560 WP_000628142.1.71922 WP_000628142.1.71945 WP_000628142.1.72054 WP_000628142.1.72120 WP_000628142.1.72126 WP_000628142.1.72155 WP_000628142.1.72293 WP_000628142.1.72362 WP_000628142.1.72391 WP_000628142.1.72392 WP_000628142.1.72414 WP_000628142.1.72574 WP_000628142.1.72593 WP_000628142.1.72615 WP_000628142.1.72651 WP_000628142.1.72738 WP_000628142.1.72778 WP_000628142.1.72804 WP_000628142.1.72806 WP_000628142.1.72956 WP_000628142.1.73015 WP_000628142.1.73193 WP_000628142.1.73278 WP_000628142.1.73498 WP_000628142.1.73592 WP_000628142.1.73631 WP_000628142.1.73652 WP_000628142.1.73980 WP_000628142.1.74213 WP_000628142.1.74243 WP_000628142.1.74294 WP_000628142.1.74465 WP_000628142.1.74716 WP_000628142.1.7479 WP_000628142.1.74793 WP_000628142.1.74873 WP_000628142.1.74879 WP_000628142.1.74914 WP_000628142.1.74993 WP_000628142.1.75138 WP_000628142.1.75143 WP_000628142.1.75155 WP_000628142.1.75219 WP_000628142.1.75221 WP_000628142.1.75247 WP_000628142.1.75602 WP_000628142.1.75698 WP_000628142.1.75803 WP_000628142.1.76089 WP_000628142.1.76118 WP_000628142.1.7637 WP_000628142.1.76452 WP_000628142.1.76466 WP_000628142.1.76544 WP_000628142.1.76612 WP_000628142.1.76705 WP_000628142.1.76884 WP_000628142.1.77120 WP_000628142.1.77288 WP_000628142.1.77391 WP_000628142.1.77448 WP_000628142.1.775 WP_000628142.1.77542 WP_000628142.1.77600 WP_000628142.1.77725 WP_000628142.1.77741 WP_000628142.1.7795 WP_000628142.1.78059 WP_000628142.1.7806 WP_000628142.1.78097 WP_000628142.1.78340 WP_000628142.1.78390 WP_000628142.1.7851 WP_000628142.1.78553 WP_000628142.1.78696 WP_000628142.1.78746 WP_000628142.1.79088 WP_000628142.1.79090 WP_000628142.1.79092 WP_000628142.1.79226 WP_000628142.1.79308 WP_000628142.1.79416 WP_000628142.1.79869 WP_000628142.1.79944 WP_000628142.1.80011 WP_000628142.1.80192 WP_000628142.1.80292 WP_000628142.1.80388 WP_000628142.1.80545 WP_000628142.1.80594 WP_000628142.1.80676 WP_000628142.1.80731 WP_000628142.1.8074 WP_000628142.1.808 WP_000628142.1.80843 WP_000628142.1.80882 WP_000628142.1.8091 WP_000628142.1.81071 WP_000628142.1.81180 WP_000628142.1.81281 WP_000628142.1.8156 WP_000628142.1.81688 WP_000628142.1.81692 WP_000628142.1.81819 WP_000628142.1.81881 WP_000628142.1.82032 WP_000628142.1.82061 WP_000628142.1.82095 WP_000628142.1.82116 WP_000628142.1.82280 WP_000628142.1.82320 WP_000628142.1.82330 WP_000628142.1.82438 WP_000628142.1.82614 WP_000628142.1.82705 WP_000628142.1.82780 WP_000628142.1.83033 WP_000628142.1.83051 WP_000628142.1.83160 WP_000628142.1.83177 WP_000628142.1.83466 WP_000628142.1.84074 WP_000628142.1.84462 WP_000628142.1.84518 WP_000628142.1.84675 WP_000628142.1.84768 WP_000628142.1.84878 WP_000628142.1.84916 WP_000628142.1.85141 WP_000628142.1.85156 WP_000628142.1.85305 WP_000628142.1.85369 WP_000628142.1.85385 WP_000628142.1.85546 WP_000628142.1.85563 WP_000628142.1.85601 WP_000628142.1.85685 WP_000628142.1.85767 WP_000628142.1.85793 WP_000628142.1.85800 WP_000628142.1.85895 WP_000628142.1.86063 WP_000628142.1.86145 WP_000628142.1.86280 WP_000628142.1.8635 WP_000628142.1.86518 WP_000628142.1.86846 WP_000628142.1.86935 WP_000628142.1.86975 WP_000628142.1.87059 WP_000628142.1.87177 WP_000628142.1.87339 WP_000628142.1.87608 WP_000628142.1.8771 WP_000628142.1.87984 WP_000628142.1.880 WP_000628142.1.88066 WP_000628142.1.88189 WP_000628142.1.88352 WP_000628142.1.88413 WP_000628142.1.88438 WP_000628142.1.8854 WP_000628142.1.88577 WP_000628142.1.88678 WP_000628142.1.88685 WP_000628142.1.88720 WP_000628142.1.88864 WP_000628142.1.89018 WP_000628142.1.89400 WP_000628142.1.89510 WP_000628142.1.89605 WP_000628142.1.89656 WP_000628142.1.89841 WP_000628142.1.89925 WP_000628142.1.90115 WP_000628142.1.90182 WP_000628142.1.90249 WP_000628142.1.90436 WP_000628142.1.90758 WP_000628142.1.9084 WP_000628142.1.91117 WP_000628142.1.91138 WP_000628142.1.9118 WP_000628142.1.91594 WP_000628142.1.91630 WP_000628142.1.91701 WP_000628142.1.91779 WP_000628142.1.91793 WP_000628142.1.92029 WP_000628142.1.92195 WP_000628142.1.924 WP_000628142.1.92462 WP_000628142.1.92495 WP_000628142.1.92506 WP_000628142.1.92535 WP_000628142.1.92571 WP_000628142.1.92793 WP_000628142.1.92796 WP_000628142.1.92932 WP_000628142.1.92991 WP_000628142.1.93085 WP_000628142.1.93267 WP_000628142.1.93468 WP_000628142.1.93742 WP_000628142.1.938 WP_000628142.1.939 WP_000628142.1.93921 WP_000628142.1.94429 WP_000628142.1.94516 WP_000628142.1.94523 WP_000628142.1.94690 WP_000628142.1.94753 WP_000628142.1.94801 WP_000628142.1.94877 WP_000628142.1.949 WP_000628142.1.94963 WP_000628142.1.95036 WP_000628142.1.95233 WP_000628142.1.95403 WP_000628142.1.95431 WP_000628142.1.95596 WP_000628142.1.95756 WP_000628142.1.95759 WP_000628142.1.95821 WP_000628142.1.95835 WP_000628142.1.96032 WP_000628142.1.96293 WP_000628142.1.96484 WP_000628142.1.96683 WP_000628142.1.96701 WP_000628142.1.96753 WP_000628142.1.96850 WP_000628142.1.96989 WP_000628142.1.9708 WP_000628142.1.97195 WP_000628142.1.97527 WP_000628142.1.97711 WP_000628142.1.97775 WP_000628142.1.97802 WP_000628142.1.97895 WP_000628142.1.98284 WP_000628142.1.98498 WP_000628142.1.98587 WP_000628142.1.98603 WP_000628142.1.98641 WP_000628142.1.98668 WP_000628142.1.98886 WP_000628142.1.98908 WP_000628142.1.98976 WP_000628142.1.99053 WP_000628142.1.9907 WP_000628142.1.99110 WP_000628142.1.99427 WP_000628142.1.99641 WP_000628142.1.99774 WP_000628142.1.99791 WP_000628142.1.99912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]