SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 300269.SSON_2308 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  300269.SSON_2308
Domain Number 1 Region: 172-424
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.49e-54
Family D-glucarate dehydratase-like 0.0018
Further Details:      
 
Domain Number 2 Region: 68-185
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.69e-23
Family Enolase N-terminal domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 300269.SSON_2308
Sequence length 428
Comment (Shigella sonnei Ss046)
Sequence
MPAPGIFHVCWDGKVPLTYRPHNNGEHHDPTKNQTGSRLVYWRCDSRKRCWRGDYHDQGA
NHWIDDHIATPMSKYRDYEQSRQSFGINVLGTLIVEVEAENGQTGFAVSTAGEMGCFIVE
KHLNRFIEGKCVSDIKLIHDQMLNATLYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVY
KLLGGAVRDEIQFYATGARPDLAKEMGFIGGKMPTHWGPHDGDAGIRKDAVMVADMREKC
GEDFWLMLDCWMSQDVNYATKLAHACAPYNLKWIEECLPPQQYEGYRELKRNAPVGMMVT
SGEHHGTLQSFRTLSETGIDIMQPDVGWCGGLTTLVEIAAIAKSRGQLVVPHGSSVYSHH
AVITFTNTPFSEFLMTSPDCSTMRPQFDPILLNEPVPVNGRIHKSVLDKPGFGVELNRDC
NLKRPYSH
Download sequence
Identical sequences A0A2J9W9E3 Q3YZV9
gi|74312769|ref|YP_311188.1| 300269.SSON_2308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]