SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 304371.MCP_0761 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  304371.MCP_0761
Domain Number 1 Region: 118-174
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.000000034
Family Tricorn protease N-terminal domain 0.023
Further Details:      
 
Weak hits

Sequence:  304371.MCP_0761
Domain Number - Region: 15-99
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00728
Family Vibrio cholerae sialidase, N-terminal and insertion domains 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 304371.MCP_0761
Sequence length 178
Comment (Methanocella paludicola SANAE)
Sequence
MRINDDKALANGIDNYYSYTNYVYLIWTGYPSYCTVSDIPRTTGWHNFTMIADGTQVQGY
IDDQLIVTSGEFATFNYIEMGTYWQSSCPGIYYDNVSVTSLDAIDDGSFPPGPNLTQNEK
IVFQRHMHDNGFDISVMNADGSGLIDVSNNPASDIMPAWSPDGSKIAFVSYRTGLPGH
Download sequence
Identical sequences D1YWL1
304371.MCP_0761 gi|282163431|ref|YP_003355816.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]