SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 304371.MCP_1836 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  304371.MCP_1836
Domain Number 1 Region: 82-144
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000327
Family NfeD domain-like 0.0033
Further Details:      
 
Weak hits

Sequence:  304371.MCP_1836
Domain Number - Region: 18-101
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.000157
Family ABC transporter transmembrane region 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 304371.MCP_1836
Sequence length 144
Comment (Methanocella paludicola SANAE)
Sequence
MELGWILLVAGVLFLLVELALPGYFAVVPGTILVIVGGLMILFPGLVTSPLGVALLVVLT
IIVSALTIAFYKRLAPVQKPFTTSMDSLVGRVGEVITQVSPDSIDGKVKIDSQVWSATSD
ECIDACQKVSVVKVSGVHLFVKKV
Download sequence
Identical sequences D1YZN6
304371.MCP_1836 gi|282164506|ref|YP_003356891.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]