SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3055.JGI151393 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3055.JGI151393
Domain Number 1 Region: 91-248
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000000288
Family Voltage-gated potassium channels 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI151393
Sequence length 279
Comment (Chlamydomonas reinhardtii)
Sequence
MSWNRVDGFEGNETRLGATSLGRNSTEKVPVLSDIDYQYSDYYKPKTRSSKELQADDLEL
VDLRDGDGMRAFQDEQHHTQMRKRKQWVILPDSRFRKMWINVQLFVVLYIIWVTPVRVGF
DKPATGFWFWFEGLIDFFFYTDLVLNFFTAYEHPVTGELITNHKKIALRYLRTWFVVDLL
ATFPSDYVIRGIEDPATGYWYMCPDFYFMVACPKCDQLPQLRCKTDFSFPYRYITSMYWA
YTTMTTVGGLRKLDLLRQARIQERLAELKEQSEHNKDSD
Download sequence
Identical sequences A8J968
XP_001698034.1.80978 3055.JGI151393 jgi|Chlre4|151393|Chlre2_kg.scaffold_38000131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]