SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3055.JGI153483 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3055.JGI153483
Domain Number 1 Region: 423-452
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000419
Family Retrovirus zinc finger-like domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI153483
Sequence length 477
Comment (Chlamydomonas reinhardtii)
Sequence
MEAEDKKISAAMQACDEQIAKLAKPRGTRSGQTGPAEAKYAADKLALEQQRDQAIVVIRQ
GATFKQLQARVARRKLLLARLAELQAQAQQELPELAEGASEDEAADDDGDDDDGEEVENV
DAPLGPGVIAGGTVQNKQLQKQKQTGQRQQQLGGRAVLASGQKGAARATNKLTRSPFLSP
DDSDSELLGEMWEEDAETEALRRAAGRRSNKDRLQQLLAAGAPTQPPPQLAALPQVDSVA
ALMSGLAQEKATAQLLQDIPFLQQIATATGARAPTKKPSVFDDHLQDQIDDLRQQQQLGL
QLVAQAQDASSRGLLQEHVAVVSVKLTQLQDFQQLVPWMRKAAKGHDVFMSTMQKGSAAE
KAFLKAAAKQLQHQAQAERARDRKGSGSGSGAWAAPSDDSEEEALPPPPKRQRMEPPPAF
KQQPLIETRSCACCDKMGHIWRNCPDLLRMPEAERSAKIKQLNELYSGGGARPRGRT
Download sequence
Identical sequences jgi|Chlre4|153483|Chlre2_kg.scaffold_58000045 3055.JGI153483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]