SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3055.JGI181140 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3055.JGI181140
Domain Number - Region: 295-329
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000706
Family Retrovirus zinc finger-like domains 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI181140
Sequence length 363
Comment (Chlamydomonas reinhardtii)
Sequence
AAAGCTHHSAMKLGRGVGPLLLVDGLSSQGTPYAAALPDPASDVTLTVTEAASSRGLPLQ
YDTGIYVSSVGGVTSELAQIRGGLPLTVLAGTEQQHTTRVVCFVVPGPQVFDILLGTNWL
IDAYRSVWDAGRNMLGLRLPHQPDASPPAVELPLRQRNRAAGACHAVSSGRAPDTSTSRT
VIAAALACVAAPTARSHTDAVGVPPLTGTGAGTGGCTSGGRNGPESDEESSDYESGEESS
DYESGEESSGYESGEESSGYESGEESSGHESDEESSDDDSGGGGSPSASAGSAPIAPGPP
TARPTDVLCERCDSWDHHARSCPWRCDQLPCIRSFNKAQRRCAEAAVACGPADVAAERAR
DPA
Download sequence
Identical sequences 3055.JGI181140 jgi|Chlre4|181140|fgenesh2_pg.C_scaffold_440000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]