SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3055.JGI183905 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3055.JGI183905
Domain Number - Region: 202-215
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0297
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI183905
Sequence length 265
Comment (Chlamydomonas reinhardtii)
Sequence
SQFCDSPSLPMALHGHEDEELLDYDEDDFETAGEPSSEPPAVDANGDTDIADVKEEENAA
AGPSTSSVVLSCRCYHCGQPVSVALIAAETAATTGGNGGAAGGSDGRVATGSRELAAGAA
PQPAADLNGAASPPATDDAGMETEEEDNRPTPAPKRQKRADGSGPSAAVTEIADGSLPCP
PRTSDETKFGVSEAILKARKVDGLCFVCGKSGHSVKAHVGYDNWQTVVRKGGQGGRGRGR
GGGQGGGRGNKGGRGGAAGKAGGRK
Download sequence
Identical sequences jgi|Chlre4|183905|estExt_fgenesh2_kg.C_190042 3055.JGI183905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]