SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3055.JGI189449 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3055.JGI189449
Domain Number - Region: 388-420
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000175
Family Retrovirus zinc finger-like domains 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI189449
Sequence length 439
Comment (Chlamydomonas reinhardtii)
Sequence
MSTASAAARARETEAALQQQQQQQPQIPGAAGVVGANIPPVNNGDPPAQAAAAQAAAAEE
QARIAANASRLRAMPLNDTPVDEDEDMAEAAAGPSSPKLDKRTLNANTPKLVFTVEEAER
NDMTVAQLIDILADDVERIVLLADGKLPRDRVPITLWLEMAVDNLQLRGRLRAALSAEFG
GYLPVNAWHWLRTWLKKHVTSAEELSALSAWIKLKEQGGIQTLSELLQVIADMQRLLPRD
FDQLCILQALSLVPLRLRNMLLRKTLQDGKQEDWASWAEFEQVLAAHVSAFPGYGKHAGS
GGQGGTPKKQKTDASSSPGYGGGNKGDGGKGGSKGGNRSFSNRSSSGAGGSGIARPTPLH
LTGAGAAKRYPFDENKPERRLYVPNQTKADRDKLAAQNKCWICEGKGHDHKTCPNRGGTK
SGEPKSLYDRDRYWYWEKK
Download sequence
Identical sequences A8IT53
jgi|Chlre4|189449|estExt_fgenesh2_pg.C_150131 XP_001692315.1.80978 3055.JGI189449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]