SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3055.JGI205928 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3055.JGI205928
Domain Number 1 Region: 174-211
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000161
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI205928
Sequence length 497
Comment (Chlamydomonas reinhardtii)
Sequence
MASSIRFKFRAELSYSNLPFDGHYITVGELKRLIAERKGLGVDAANELQLTDATSKRDYD
NDAEQVMKNSAVIVRRVAGAAKPKTLLSSSAAPAPAAQLAPAPLPVAAAPLAAADLAAAH
IDDEFGEDPYAKAAAVKQDEQQMMAFLAHAAQGVNLEAQLAAQTAPAGRGRGRGRGGFGA
GGGRGGRGAGRECLRCGQLGHFISECPTQGDPVYDKRFKVPSGIPASKIQRNADGSLYLP
DGELGELAANTSAFNKLAAMMGRGPTGTEAAAGGTQGAQGPAAAAAATAAGPSAPAAWQD
PTHAAAALKQQQLQQQQAHSAAGADGAATTVQEQTQMQQMQQQLLMMQQRMQQLQQQQQQ
QTPDREVKQEPAQPAEPKLFDDDDHHVAGGAQAGAVQQPVKLGLGMAVDDGGQQRSASPA
PSRLTGPLANIHAQREEAAAVGGGGAGRHRRGGDDVGQDGVPSWVADVGCSRHDLTAVLP
FLRNLLPGDMSMQAVFR
Download sequence
Identical sequences A8IY15
XP_001693933.1.80978 3055.JGI205928 jgi|Chlre4|205928|SKA_Chlre2_kg.scaffold_20000066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]