SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3055.JGI206677 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3055.JGI206677
Domain Number 1 Region: 524-781
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.01e-73
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000234
Further Details:      
 
Domain Number 2 Region: 98-355
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.18e-70
Family PFOR Pyr module 0.0000000411
Further Details:      
 
Domain Number 3 Region: 358-514
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 8.9e-41
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000437
Further Details:      
 
Domain Number 4 Region: 901-1025
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.24e-36
Family PFOR PP module 0.0000281
Further Details:      
 
Domain Number 5 Region: 781-938
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 5.58e-18
Family Ferredoxin domains from multidomain proteins 0.001
Further Details:      
 
Domain Number 6 Region: 1184-1290
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.41e-17
Family PFOR PP module 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI206677
Sequence length 1324
Comment (Chlamydomonas reinhardtii)
Sequence
MEAHLKAPAVGKICRQGQVARALVPAAAGRATNAKRAAVTVMATPPEAPGAGTASAPGDY
KTAAATTTTTTTTTGQTASNLVVFPSPAVVSSAGKPGGKMAPMDGNEATALIAYAVSDVS
FIYPITPATNMGEMVDQWASEGRTNVFNNVMSVTEMESETGAAGALHGALAAGALATTFT
CSQGLLLMVPNMYKIAGELTPCVLHVTARALAKHALSIFGDHQDVMAVRQTGWAMLCSHS
VQEAHDLALVSHLATLRASVPFVHFFDGFRTSHEINTIHLIDNEAIKSILAKPIYQDAIK
HHRARALNPTHPHQRGTAQGPDVYFQCAEAANPFYDRAYDHVAAAMEEVSAVTGRVYKPY
EYVGAPDADKVIVLMGSGSAAVEEAVNYLNAQGKKVGVLKVRLYRPWNSKVLLAQIPATV
RKVAVLDRTKEPGSGGEPLYQQIAMTLHEAEMADPALPRRYIVGGRFGLASKEFLPSHAA
AVFENLDAKKPLRDFSVGIMDDVTHRSLPDSRWLPLGTRTLPKGTFECLFWGMGSDGTVG
ANKEAIKIIASSAGMSAQAYFSYDAHKSGGVTVSHLRFGPSPIDSPYLVQQADYLAVNHQ
SYMAKYDTLASLKPGGVLVLNTVFTSPDSLGKYLPDKVKKQIAALKPQLYVIDAQSVAKA
SGLGKHVNMVMQTVFFNLSGVLPMEKALALLKKSITKAYERKGPEVVAKNHSAVDMAVAA
LKKLDIPASWSSLPTHVVNPNPPAKGNTSRWEFIETVAKPMLALEGDKLPVSVFSPEGFV
PPGTTVIEKRAIAAQVPIWKAENCTQCNICAFVCPHAAIRPALASPADLVGAPATFGTIQ
AKGPGMGDLKYRIQVSPYDCTGCDLCTHACPDDALQSVPINSVLEVETANWDFAGTLPAR
TDIMDKATVKGSQLQPPLMEFSGACEGCGETPYVKLLTQAKKWVLFCARLLTQLFGDRLI
IANATGCSSIWGGSAPSNPYTTNADGYGPAWANSLFEDNAQFGLGIAMGTMQRRKTVRKH
VQEVLAVEAEKMPLSFGLRNALTRWDEHFDEPEVANVVAKELQPLLEREKGGREERGCQP
EREGRAPLDQAAVRRTRHAAQGLHLDRGRRRLGLRHRLRRLGPRAGQRREREHPGAGHRG
LLQHRRPALQGHAQIGRDQVRGGRERAPQEGPGRHRHELRRRLAYAPCIMHGISSGMCSA
IDESKQAVETGYWPLYRYNPAVKEDATHHRFQLDAKKLKGDVEEWLSHENRFQILERKNP
EVAHKLHHELDDAVHERFDRMKHMAAGGHMEPGSPPPPAAAAPQAQAPDHGHQHNTKESG
CGGH
Download sequence
Identical sequences 3055.JGI206677 jgi|Chlre4|206677|SKA_Chlre2_kg.scaffold_62000019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]