SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3055.JGI284369 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3055.JGI284369
Domain Number 1 Region: 120-154
Classification Level Classification E-value
Superfamily WW domain 0.000000000114
Family WW domain 0.0026
Further Details:      
 
Domain Number 2 Region: 8-34
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000335
Family Retrovirus zinc finger-like domains 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI284369
Sequence length 160
Comment (Chlamydomonas reinhardtii)
Sequence
MEKHHLLRRDPNWHPNGCNLCGQLGHQAANCPNGTINWRQIYGDDAFIMRQPIFYSDIAA
RLKYKEEGMRDLEARAREYAKKRAEEQGLSWDEMMAKAEELRNKDPAETIPKAMAPAGGE
EAPLPAGWAVATDASGRSYFWHKKTQKVQWERPTEDTPIN
Download sequence
Identical sequences A0A2K3D2E9
jgi|Chlre4|284369|au.g2800_t1 3055.JGI284369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]