SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3055.JGI336380 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3055.JGI336380
Domain Number 1 Region: 424-452
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000377
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI336380
Sequence length 477
Comment (Chlamydomonas reinhardtii)
Sequence
MEAEDKKISAAMQACDEQIAKLAKPRATRAGQTGPAEAKYAADKLALEQQRDQAIVAIRQ
GATFKQLQARVARRKLLLARLAELQAQAQQELPELAEGASEDEAADDDGDDDDGEELENV
DAPLGPGVIAGGTVQNKQPQKQKQTGQRQQQLGGRAVLASGQKGAARATNKLTRSPFLSP
DDSDSELLGELWEEDAETEALRRAAGRRSNKDRLQQLLAAGAPTQPPPQLAALPQVDSVA
ALMSGLAQEKATAQLLQDIPFLQQIATATGARAPTKKPSAFDDHLQDQIDDLRQQQQLGL
QLVAQAQDASSRGLLQEHVAVVSVKLTQLQDFQQLVPWMRKAAKGHDVFMSTMQKGSAAE
KAFLKAAAKQLQRQAQAERARDRKGSGSGSGAWAAPSDDSEEEALPPPPKRQRMEPAPAF
KQQPLIETRTCACCDKMGHVWRNCPDLQRMPEAERTAKIKQLNELYSGGGARPRGRA
Download sequence
Identical sequences 3055.JGI336380 jgi|Chlre4|336380|pm.chromosome_3_#_641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]