SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3055.JGI344809 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3055.JGI344809
Domain Number - Region: 361-381
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000628
Family Retrovirus zinc finger-like domains 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI344809
Sequence length 948
Comment (Chlamydomonas reinhardtii)
Sequence
MTLGPSPTQQCRSDAANSSSGGGGNGDGAGMSSWEDKLRCHAQPAAAATARTAGHKRRRV
ITPALDQSDTDAAAGGSGIDAGGCNRLATAAAAAAAAAAQPSGRPPPTVPAAPSPAPAAA
AGAQQPNHTERLLQRARAMAEAANFNTAFERANNTPAYDRLRVMPLKLGVGLAASSVPVD
TAPAPLTAVLPAASDADGGASLQAVRAGGSRAPDPASRGGASARAPGGAAPAAAPGIPLA
GGQQMSWRRDSGTRGEGAVQTAGEAAAEDAAAAEAAGELPKELLAKVMGPVRPVLLSPSG
VPLAPRPEAGGAFCGGGAAGGGGGGRPQKRQRSNGAHATNGGGGDGGLQALKPQYNFLLS
RCWNCGSYGHDIQTCFRPRNQAAVDLNRRAAAETRAAQEEAREAARVARAATRQQRQGGG
GGARERGSAHNRYFTAELLPEEDAAQPPSTTLAPDTAGTGTGIGTGTDADAGGPTAPGWS
DRPLKTAPPGVRPGVLSKALAAALGLASPLDPPPWLTAMALYGLPPSYCDSVRVAAAVAA
AERAAGRGGGAAGIRVYGADGEALPMPGDQAEEDEDVEEQEEEVAEAEAPSGAAAREQGE
QVREAARLSAAATVAVTAAAAAAVAVAEAAMAGDVAEPQAAADEVGQAHGGAVMDVASEP
AGGSDGSVGAGPSGEMSRGERCSLRAALEALVCTGALAALGDALLGTHTASAADAGATSN
GNGVSGGGAASMQQMQEHGSSDGATGPARAEGATCDNPRDHDAAEAGAPPLPSPSQAGQP
AEQPAVGQGASNEAEPDREDLAAPPSPGPPPPPLEPVDMLLPSEPRLVLFPGLNAPPPGA
VRMRVKAAWARALANAQRVQAAVAAAVGPLVPRRPIAGEQDAAEHPMEEGWRAAARAGVS
RDGGGVGSAGGSSSGQQPGSHAASDPACSTSTRRIGGTARHDLQPSPT
Download sequence
Identical sequences 3055.JGI344809 jgi|Chlre4|344809|estExt_fgenesh1_pg.C_chromosome_70375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]