SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3055.JGI345821 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3055.JGI345821
Domain Number 1 Region: 223-259
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000174
Family Retrovirus zinc finger-like domains 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI345821
Sequence length 302
Comment (Chlamydomonas reinhardtii)
Sequence
MNDEGGVCGKPIMLEQSTAHIWYSKLRIYLNWKELGPAIRDDDAPEAKQQKAVALILSHV
RLSDHFIYEELLETLEAEKKANPTAKQNEAKRLVQALMVYYKKLAAGNHRQWAADLGSVR
LGASEQISELIQRIADMVERLCWSGCPGYTNGDRDRLVVSAAFNALPQEYASVVAIAEEF
YTSTARWSVPDAESRLTRFQNTLTSVRGSSSSGEPSIHFVRGVGGGRGGRGGRGVRSKEN
VQCHRCQGWGHYKNECPEQAAEGGGGNRGRGAHVGRDSGDRRMFAVNVDQGNGRGRGRGV
CA
Download sequence
Identical sequences A0A2K3E1K2
jgi|Chlre4|345821|estExt_fgenesh1_pg.C_chromosome_110041 3055.JGI345821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]