SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3055.JGI407969 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3055.JGI407969
Domain Number - Region: 994-1028
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00593
Family Retrovirus zinc finger-like domains 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI407969
Sequence length 1600
Comment (Chlamydomonas reinhardtii)
Sequence
MASSSSSSSAPASAGGCPLWPMPLPAWQPHLLAQLDHAAAAAAPPAAAAGAPPAALAGGS
GGVARMGMAAAHLAAAAPANGAPLSSAGAAWPSAAAMLRPARPIPSWSQTGRQQYDGERA
GRARFMVDAHGYTEEQAACADINSPYAQDPRLIARALINGASVPESRAWVWNNEELDGGQ
RTLERHRGQWVAVGGSLVDWRGQAFIDADGTVRVPHVAHFWLAEFLAAMHTPASFGPSPL
FGFTLGATEAATAAAQRFLSLHRADTALCHKDMLGKVFSEGVMRTAVTQPWRDLFIMNLT
REQKALPEGQVLSVTLVANCLAEAQAAFRGIAAPTPAAAVHVTAASSAAASPAPAAAPAA
PAAPAAPAAPPAPAAAAPAAAAHAHQVNQLPVVSQADLMRRENLVPDTTVNQRKPGDAQW
CLYHQTSHHAADQCRAYSALVSSNRAREAARRIATGEGARAFHKAPAPAPAQAHAHVTAA
LPAETAQPASAAALCPPHRAARRELADDLSVATVRSLYDNGGHSERPPLPSATAAVSHSQ
VAGASGMELGDCWDAEFGPAHIFHLAARPPSSGPMQSALPLSFQPLPAAAARRCAPAPAD
GAATPTASSSTTSAACPSATTGSDAAASTSTRPAAAIPAATAASSDGAPSGADNRVRAHL
NDAKFAALHAVLRDQGLQITRLEGDVRRYARLLRRLDAQAAAGCTHHSAMKLGRGVGPLL
LVDGLSSQGTPYAAALPDPASDVTLTVTEAASSRGLPLQYDTGIYVSSVGGVTSELAQIR
GGLPLTVLAGTEQQHTTRVVCFVVPGPQVFDILLGTNWLIDAYRSVWDAGRNMLGLRLPH
QPDASPPAVELPLRQRNRAAGACHAVSSGRAPDTSTSRTVIAAALACVAAPTARSHTDAV
GVPPLTGTGAGTGGCTSGGRNGPESDEESSDYESGEESSDYESGEESSGYESGEESSGYE
SGEESSGHESDEESSDDDSGGGGSPSASAGSAPIAPGPPTARPTDVLCERCDSWDHHARS
CPWRCDQLPCIRSFNKAQRRCAEAAVACGPADVAAERARDPARSPCRAFPTASPSPPPPP
PGSAASSPPPPPQPPSSGLPPPLQLLAAAAPSPAFAWAPPSPGSAAPSPPPPPQPPGSAS
PPPLQLVATAAPSPAYATAPPSPGSAASSPPPPPQPPGSVWPPPLQLLAAAAPSPAFAWA
PPSPGSAAPSPPPPPQPPGSASPPPLQLVATAAPSPAYATAPPSPGSAAPSPPPPPQPPG
PASPPPLQLLAAAAPSPAYAWAPPSPPPPPQHPGSASPPPLQPPGSVLPPPLQLLAAAAP
SPADAWAPPSPGSAASSPPRPPQPPGSVLPPPLQLLAATAPSPAYAWAPPSPGSAASSPP
PPPQSPGSASPPPLQLLAAAAPSPAHATAPPSPGSAASSQPRPPQPPGSAPRPPAYTSAL
PLPGFADLLPPPRRSPGSPPPLLAPSPQRPGSAADPWRSKLPSETWWQFLGRMRAAGIHL
TAMPESEWAGQGRPPPEADPPPLSASRSASPVHQVALGFAAPPSPAVASSAAASAAPSPA
AGRTPERMTFDALLLRHAAAEAAASSTYPGAPPPGRPAPL
Download sequence
Identical sequences jgi|Chlre4|407969|pasa_Sanger_mRNA35888 3055.JGI407969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]