SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3055.JGI410167 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3055.JGI410167
Domain Number - Region: 1483-1517
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00593
Family Retrovirus zinc finger-like domains 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI410167
Sequence length 1594
Comment (Chlamydomonas reinhardtii)
Sequence
MTSPPQSDQGRGLRRSLRVQGRATAPAAAGPSAAERVQAHGPARRVAAEAPEAAAAHAAA
AAAPAPAAILAPLAAAGAAYGVAAAAAPVAAAAPAFAAPVQPPAAAGAAYGVAAAAAPVA
AAAPAFAAPVQPPAAAGAAYGAAAAAAPVAAAAPAFAAPAQPHAAAGAAYGAAAATAPGA
AAAPAFAAPAQPPATAGAAYGAAAATAPGAAAAPAFAAPAQPPAAAGAAYGAAAAAAPVA
AAAPAFAAPAQPPAAAGAAYGAAAAAAAGPSATAAGLPPRHPGRAQSVSNFDQALRRAFG
APAAPRSVRATPAAGVGLQGAFLALGVPDVLRRRGRTWASDATGSSASSYRPSDSASETS
STADTASGRRRAAARELTELSPAGANNGRRVCNNPAYEEEEELQAALARSRRDTGHPRPP
PPAGRAAALLTETAVTVHEMLGGGPTAAAPAAAAVPAAAAAADAPAPPAAAAGPGPDAAA
PQLPVSVVNMASSSSSSSAPASAGGCPLWPMPLPAWQPHLLAQLDHAAAAAAPPAAAAGA
PPAALAGGSGGVARMGMAAAHLAAAAPANGAPLSSAGAAWPSAAAMLRPARPIPSWSQTG
RQQYDGERAGRARFMVDAHGYTEEQAACADINSPYAQDPRLIARALINGASVPESRAWVW
NNEELDGGQRTLERHRGRWVAVGGSLVDWRGQAFIDADGTVRVPHVAHFWLAEFLAAMHT
PASFGPSPLFGFTLGATEAATAAAQRFLSLHRADTALCHKDMLGKVFSEGVMRTAVTQPW
RDLFIMNLTREQKALPEGQVLSVTLVANCLAEAQAAFRGIAAPTPAAAVHVTAASSAAAS
PAPAAAPAAPAAPAAPAAPPAPAAAAPAAAAHAHQVNQLPVVSQADLMRRENLVPDTTVN
QRKPGDAQWCLYHQTSHHAADQCRAYSALVSSNRAREAARRIATGEGARAFHKAPAPAPA
QAHAHVTAALPAETAQPASAAALCPPHRAARRELADDLSVATVRSLYDTGGHSERPPLPS
ATAAVSHSQVAGASGMELGDCWDAEFGPAHIFHLAARPPSSGPMQSALPLSFQPLPAAAA
RRCAPAPADGAATPTASSSTTSAACPSATTGSDAAASTSTRPAAAIPAATAASSDGAPSG
ADNRVRAHLNDAKFAALHAVLRDQGLQITRLEGDVRRYARLLRRLDAQAAAGCTHHSAMK
LGRGVGPLLLVDGLSSQGTPYAAALPDPASDVTLTVTEAASSRGLPLQYDTGIYVSSVGG
VTSELAQIRGGLPLTVLAGTEQQHTTRVVCFVVPGPQVFDILLGTNWLIDAYRSVWDAGR
NMLGLRLPHQPDASPPAVELPLRQRNRAAGACHAVSSGRAPDTSTSRTVIAAALACVAAP
TARSHTDAVGVPPLTGTGAGTGGCTSGGRNGPESDEESSDYESGEESSDYESGEESSGYE
SGEESSGYESGEESSGHESDEESSDDDSGGGGSPSASAGSAPIAPGPPTARPTDVLCERC
DSWDHHARSCPWRCDQLPCIRSFNKAQRRCAEAAVACGPADVAAERARDPARETWWQFLG
RMRAAGIHLTAMPESEWAGQGRPPPEGAVAAATR
Download sequence
Identical sequences 3055.JGI410167 jgi|Chlre4|410167|pasa_Sanger_mRNA17902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]