SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3055.JGI420695 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3055.JGI420695
Domain Number 1 Region: 16-49
Classification Level Classification E-value
Superfamily TAF(II)230 TBP-binding fragment 0.0000471
Family TAF(II)230 TBP-binding fragment 0.0049
Further Details:      
 
Weak hits

Sequence:  3055.JGI420695
Domain Number - Region: 826-859
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00209
Family Retrovirus zinc finger-like domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI420695
Sequence length 1276
Comment (Chlamydomonas reinhardtii)
Sequence
MPPRRHDGEEEDGGGIMGSILFGNIDEEGRADVDYLDEDAKQNLGSIAAQLGKEDNLAQE
VADDGRGGDGAAAAAMVMPVAGAVNYEAETEEVEDYDAPPRAAAPPVPMWVGWAAAAAGA
AAAGVAGVAAAVDLDADLEAAFDSPEARQDALGVEYLTVLPSGERVIRHTTLHIFTGDRH
AADIREAAAENYAAAATARERQLRMQKQHAARLAAEAVRRERLAAAAVAEAAATAAEAAA
AGAGAGGAEAAKAAAAAAAALELDPELDEQRRAAAAGRLPAALVDDLALMRPGPGAAAKT
QAEIEAAELAAALAAAQAAAAAAAAGVATEEELELEFEDEDLEGGGGAGAAGGEGAKRAA
EVEARPRRPCDPSKCPIHSYVPGPMNPEYELPEGVQVTEEAKLREMLRPDVVCAYESMRA
AELRLKGLGLGHVQHLTEVARNEPERWQAAVRQLAELNPKAGNALRLIDWAVNTAPWVTT
GSYTTATRGDMRHSTWLRVEGPFDPTGRGYGLCYQADWNRVTGRPESLKEKPPAEGSITG
TDADLRKLGHEEAGRMLMGWGVKKEVVDSMTNRWRRIDLVRKLATQAALEGTEGFNQHYV
RMQKINVTEKIGGARRTAAAILQKQLDALRRDRDWGPPQEDYGLLRPLSRRSAASSAAAA
AAAEDEEERRAYAELAREGFLGAGGDKAAGGKPKKGGPLEAKAKDRRIRRTLELLGPPDP
DTGVPAVVGRRELLYRDRMEMQTVNRGLNRGEQGGFGQAVLHPPASNFMPGPYVMRRMAA
GTTRRAGKPRPEPKEEAAKEAKEAKPPKERKPRPPRDPNAPPKPRKPAAPRVKQQANVCA
DCGQPGHKAYTRQCPNFAGEVSLSDTDETETEDMLDDGGGGGGADGGIDGGAAPTDSAAP
AGTVTTTGADGAGGAAADGTPGGAGAGVTPQTGGRAARRRPSKKIREEEEEPIDEDDEDV
VISEDEDWDAYASDEDLPMNRPRGFGGGGGGGRRRGGGAGGAGRGGGRAGRGGRGGGRGA
AREYRERAPRQKRFKEEFDLIDDDDDEEEDIPEEPDEDFNDVLEDEEDEGEDWMEEGSED
EEAPAAKYKPRGTTNRARGKPPPAAEPEGIAASRSRRAGAGAASGGGVPPAQDVEMAVAA
PPPAPVVAAPQRVAAAPPPPPAAIAAAAPVAFTPPPMPVYAPPPPAPVPQQQYRAPPPAP
PPPPQQQQPPNANTSRTMMTTTTAAATRRKRRTTTTMRRAAAAAAAASAAAVAEELPPLP
AEPAPLTAKPPPLAAG
Download sequence
Identical sequences 3055.JGI420695 jgi|Chlre4|420695|pasa_Sanger_mRNA3488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]