SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 306263.Cla_0117 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  306263.Cla_0117
Domain Number 1 Region: 8-92
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000196
Family Anti-sigma factor antagonist SpoIIaa 0.0094
Further Details:      
 
Weak hits

Sequence:  306263.Cla_0117
Domain Number - Region: 185-211,274-329
Classification Level Classification E-value
Superfamily NIF3 (NGG1p interacting factor 3)-like 0.0432
Family NIF3 (NGG1p interacting factor 3)-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 306263.Cla_0117
Sequence length 370
Comment (Campylobacter lari RM2100)
Sequence
MKNKIIKDVKNHECIFSVFGIWDKTSVGKLEKLDFPTQKNIIFDFTNLDFIDTAGIRYFL
ALENELKQKGFELSRVNLKSEHAKLFELCQKHYKSFCDSYEDKKTIKDFFENLGKKVVES
FTLLVQFLNFIGLIIATCFNTLFHLKKLRFRAFLYHVENSAINALPIIMLTSLLVGVVLA
YQAAYQLAQFGANIYIVDLMGISATRELAPLISAIVIAGRSASSYTAQIGVMKLTDEIDA
MKTMGFKESEFIILPRVLALALAMPLVVIVADILSIIGGIIVAWFSLEISASEFMSRFKE
AVELKHIIIGLIKAPIFGFLIASIACFRGFFVQKTTESIGVYTTKSVVNAIFWVIAFDAI
FSVFLTKAGF
Download sequence
Identical sequences B9KEJ8
WP_012660868.1.78799 gi|222823161|ref|YP_002574734.1| 306263.Cla_0117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]