SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 306263.Cla_0388 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  306263.Cla_0388
Domain Number 1 Region: 794-1180
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.65e-118
Family PFOR PP module 0.00000000613
Further Details:      
 
Domain Number 2 Region: 416-662
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 7.45e-80
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000172
Further Details:      
 
Domain Number 3 Region: 5-258
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.83e-76
Family PFOR Pyr module 0.0000000168
Further Details:      
 
Domain Number 4 Region: 260-411
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.3e-44
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000199
Further Details:      
 
Domain Number 5 Region: 671-837
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3.35e-17
Family Ferredoxin domains from multidomain proteins 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 306263.Cla_0388
Sequence length 1184
Comment (Campylobacter lari RM2100)
Sequence
MSKIMKTMDGNEAAAYAAYAFTEVAGIYPITPSSPMADYTDIWASQGKKNLFGVPVKVVE
MQSEAGAAGTVHGSLQAGALTTTYTASQGLLLKIPNMYKIAGQLLPGVIHVAARALASQA
LSIFGDHQDVYAARQTGFAMLCSHSVQESMDLAGVAHLAAIKGRVPFMHFFDGFRTSHEI
QKIEVMDYAHFDRLLDREALMEFRNSCLNPENPKTRGTAQNDDIYFQTRELANKYYEAIP
DIVNEYMQEISKITGREYKPFVYYGDKNATRIVVAMGSVTEALKEVVDHLNSKGEKVGVL
KVHLYRPFSLKYLFDAMPQSVEKIAVLDRTKEPGSLGEPLYLDLKSAYYGKEKAPLIVGG
RYGLSSKDVDPAQLLAVFENLNQANPKDGFTIGINDDVTFTSLPVGEKISLGDESTIECL
FYGLGADGTVGANKNSIKIIGDKTDFYAQAYFAYDSKKSGGYTRSHLRFSKKPITSTYLV
STPHFVACSVAAYLEIYDVLAGIRKGGTFLLNSIWNAQETIKRIPNSVKRVLAQKEINFY
IINATKLAREIGLGSRTNTIMQSAFFKLANIIPFEDAQKYMKELAYKSYSKKGDAIVEMN
YKAIDVGADGLVKVDIDPSWANLTDEVKEETIAYKGTEFVEKIAKPMNAAKGDDLPVSAF
LGYEDGSFEHGTTEYEKRGVGVMVPRWIETNCIQCNQCASVCPHAVIRPFLIDEKELENA
PAGVKEHSLNAKGVKEQKLNFKIQVSPLDCTGCELCVHECPTKEKSLVMVPLGEELDHGE
QENADYLFKKVSYKDNILNRENAKGIQFAQPLFEFHGACPGCGETPYITLITRLFGERMI
IANATGCSSIYGGSAPSTPYRKSNKNSHGPAWGNSLFEDNAEFGLGMKIATETTRHKIEQ
IMNESMQEVPNALSALYKEWIANKEDSKASLELRDKLVPLLEENKQIKTVNDILELKSYL
SKKSHWIFGGDGWAYDIGYGGLDHVLASGENVNILVLDTEVYSNTGGQSSKSSRTGSVAQ
FAAAGKPVQKKDLGQIAMTYGYIFVAQVNSNANYAQLLKAIIAAEAYDGPSLIIAYSPCI
AHGIKGGLGNSGNQAELATKCGYWPTYIYDPRLEAEGKNPLTISSKEPDWDLYESFLMNE
VRYNSLKKSNPEHAKELFEKNKAEAQRRYRQLKRLASADFSNEN
Download sequence
Identical sequences B9KFB1
306263.Cla_0388 WP_012661129.1.78799 gi|222823423|ref|YP_002574997.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]