SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 306537.jk0964 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  306537.jk0964
Domain Number 1 Region: 77-142
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000248
Family NfeD domain-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 306537.jk0964
Sequence length 146
Comment (Corynebacterium jeikeium K411)
Sequence
MGPIIWLIAAGVLALGELLVADMSLLMLSAAALITAGVSLADIPVWAEILVFGLASLATI
LAIRPILRKRLLQARSERTFDHSELTGMNAKVVEPVTDDVQSGGMVRIAGELWSARSANM
GDTYSQGQSVQVIDIDGTTAVVWGNN
Download sequence
Identical sequences A0A1G4VZ15 Q4JVM9
306537.jk0964 WP_011273544.1.58937 WP_011273544.1.86212 gi|68536041|ref|YP_250746.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]