SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 309798.COPRO5265_0787 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  309798.COPRO5265_0787
Domain Number 1 Region: 1-179
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.18e-42
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 309798.COPRO5265_0787
Sequence length 182
Comment (Coprothermobacter proteolyticus DSM 5265)
Sequence
MTRNVVAAGFGGQGVMLLGQILALAATQKQLNATWLPSYGPEQRGGTANCTVVVSDEEIG
SPVVDKPMYVVIMNNPSMEKFEKMVEPNGTVILNSTLITLEPKRTDVNYLKVPANELAEQ
AGSQRSANMVMLGVIGWLWKDIFTLEELEQAMVEKVGDKRPQLVETNKKAIELGYEFAKN
LV
Download sequence
Identical sequences B5Y8N7
WP_012543807.1.90209 309798.COPRO5265_0787 gi|206895460|ref|YP_002247134.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]