SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 309798.COPRO5265_1077 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  309798.COPRO5265_1077
Domain Number 1 Region: 2-174
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.62e-33
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 309798.COPRO5265_1077
Sequence length 177
Comment (Coprothermobacter proteolyticus DSM 5265)
Sequence
MRREVYIVGSGGQGVVLMGALLAEAYALKNWNVVQTVVYDAAQRGGLARAEVVMSDTEIY
YPKVRKADVVVAFSSDALPGAKSKMNGHTVILADESLRDKGVESLGFKVVYVPFERWARE
ELHSARVMNMVALGYCLKTLGDISLEEVEMALKERFKGDLFKLNMAAVKIGLEASEF
Download sequence
Identical sequences B5Y9E1
WP_012544695.1.90209 gi|206896350|ref|YP_002247388.1| 309798.COPRO5265_1077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]