SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 309798.COPRO5265_1459 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  309798.COPRO5265_1459
Domain Number - Region: 19-52
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0288
Family NfeD domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 309798.COPRO5265_1459
Sequence length 54
Comment (Coprothermobacter proteolyticus DSM 5265)
Sequence
MEGYIFAIDGVRVAASGIQLTYDDGNVEILNEDWKVFSKASLGQGAQLMLPKTE
Download sequence
Identical sequences B5Y637
309798.COPRO5265_1459 gi|206896424|ref|YP_002247716.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]