SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 309799.DICTH_0603 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  309799.DICTH_0603
Domain Number 1 Region: 4-185
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.58e-25
Family Clp protease, ClpP subunit 0.065
Further Details:      
 
Domain Number 2 Region: 361-420
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000562
Family NfeD domain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 309799.DICTH_0603
Sequence length 423
Comment (Dictyoglomus thermophilum H 6 12)
Sequence
MKKIFITIFLLFLILSSIYAQNQNVYIIPIKGTIELGLASFVERSIREHPNAKAFIFEID
TFGGRVDAAIKIRDTILATPTLTIAFIKDRAWSAGALIALSCEKIVISPSGSIGAAEPRP
ADEKTISALKAEFESTAKKRNRNPKIAAAMVDADEVIPGLKQKGKILTLYAEEAKKWKIA
DEILENTDSVIKFFNLEKGKIIELQPNWAENFVRFITDPTVSSIILTVGMLSLYVAIFTP
GLGVPELLALVCLGLFFGGHYLAGLAGLEPVILFLLGLILIFIEMHTPGFGIPGIAGSIS
VFLSIYWTIVQKGGTLQALLTGILVVLSLIIFLAIYLPKSRVWIKFGLPESQKKDLGYTA
FQERKDLIGKKGKTITMLRPTGIIEIEGEKFEAYSESEFIEPSEEVIVFKVEGNKIFVRR
SEK
Download sequence
Identical sequences B5YD75
gi|206900657|ref|YP_002250483.1| 309799.DICTH_0603 WP_012547450.1.10127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]