SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 309799.DICTH_1229 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  309799.DICTH_1229
Domain Number 1 Region: 164-410
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.44e-80
Family D-glucarate dehydratase-like 0.000000261
Further Details:      
 
Domain Number 2 Region: 2-159
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.26e-46
Family Enolase N-terminal domain-like 0.00000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 309799.DICTH_1229
Sequence length 417
Comment (Dictyoglomus thermophilum H 6 12)
Sequence
MIKDAFYSIGLSGFYFDDQRAIKAGAKEDGFAYRGVPLTSGYEAVRQKGESISVMLFLDD
GQIAFGDCAAIQYSGAGGREPLFKARDLAKDLEKVVFPFLMNEKWSSFREMCQKLEDLRV
NGKKLHTAIRYGVSQVILDTFAKYYKKTMTEIIRDEYSLNFEIKKVPIFAQSGDERYINA
DKMILKRVDVLPHALINNVETKLGWRGEKLIEYLGWLKERVRILGGDNYYPVFHIDVYGT
IGIAFQYNVDEIAEYLGRLEKICYPYKLRIEGPVDMESKELQIEFLSKLRKKLKEKGIKV
DIVADEWCNSLNDIKDFIKAEAVDMIQIKTPVLGSIHNSIEAVLYCKENNIGAYLGGSCN
ETDRSAQVSVHVALATQADQILAKPGMGVDEGLMIVYNEMMRTLRILKRKGLNVIDD
Download sequence
Identical sequences B5YEV0
WP_012547215.1.10127 309799.DICTH_1229 gi|206900422|ref|YP_002251058.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]