SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 309801.trd_1267 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  309801.trd_1267
Domain Number 1 Region: 31-201
Classification Level Classification E-value
Superfamily ClpP/crotonase 7.05e-29
Family Clp protease, ClpP subunit 0.066
Further Details:      
 
Domain Number 2 Region: 373-439
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000068
Family NfeD domain-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 309801.trd_1267
Sequence length 469
Comment (Thermomicrobium roseum DSM 5159)
Sequence
MRYWQNLRSRCMSLFLMIVGLALLGQSGAAASTRVYLVEIDGAITPVVASYVDRALRQAA
DQGAEAVVIQLDTPGGLSSAMDEIIQDILQSPVPVIVYVAPEGARAASAGVFITYAAHIA
AMAPATNIGSASPVLIGQDGQAAQPDDTMQRKVVNDAVAKIRSLAERRGRNADWAEQAVR
EAVNISAEQAVAQNVVDLVAPSLPALLDAVDGRTVTTSAGQVTLRTRAAEVVPIQMTLIE
RFFQVLSDPNVAYILLSLGMLGLFFELANPGSILPGVLGGILLLLGLYALGTLDVNWAGV
LLMGFAFLLFLIDLYVPTHGVLTIGGIVSFALGSLLLLQSPASPAFQLSRAVVIAVTATI
AGVFLLLVYLVARAHARRPQTGKEALLGARAVVRRTLDPEGMVFVEGELWRARSLAGTIP
AGRTVRVVGVEGLVLLVEPASEEEPAVRVRRLAGDVRRWRPLGALFRRG
Download sequence
Identical sequences B9L1K7
gi|221633249|ref|YP_002522474.1| 309801.trd_1267 WP_015922218.1.69661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]