SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 309801.trd_1958 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  309801.trd_1958
Domain Number 1 Region: 96-120,155-390
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 9.96e-70
Family D-glucarate dehydratase-like 0.00022
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.86e-25
Family Enolase N-terminal domain-like 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 309801.trd_1958
Sequence length 399
Comment (Thermomicrobium roseum DSM 5159)
Sequence
MRIVALETLRLNEFPNLLWVRLHTDKGYVGIGETFFGAQAVESYLHESVAPYLLGQDPRD
IQRHARALRQYVGFCGTGVEQRGNSAIDLALWDLIGRATGQPLYQALGGRVRTEIPVYNT
CAGYRYIRAQPRQAVENWGLPENPSEGPYEDLEAFLTRPDALARDLLAMGIRAMKIWPFD
PEAERTNGQFLSLSDLERCLEPFQRIRATVGQEMELLVELHGLWNLPMAVRIARALEPLK
PLWIEDPIRSDDLDALATLARVTPIPLALSETLGPRSAFRQLLEQRIPGFILFDLGWCGG
LTEARAIAAMAEAYQLPVAPHDCTGPIVFTASVHFSLSIPNSFIQEFVRAFYFGWYQEIV
TNLPPFANGLISAPEEAGLGTDLRPELWERSDVHIRISH
Download sequence
Identical sequences B9L2R5
WP_015922899.1.69661 309801.trd_1958 gi|221633930|ref|YP_002523156.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]