SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 309801.trd_A0426 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  309801.trd_A0426
Domain Number - Region: 7-120
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0103
Family LacY-like proton/sugar symporter 0.05
Further Details:      
 
Domain Number - Region: 103-168
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0235
Family NfeD domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 309801.trd_A0426
Sequence length 184
Comment (Thermomicrobium roseum DSM 5159)
Sequence
MSLLAITYLVIALVGLAFLALTVLIGEIADIFDVGDDGIGPFNGKVIAVALTAFGATGLL
MTFFRVPVLWGALAAAGSGLAFGLAAWLLVALLYRQQATTEFSLQDLLGRTGEVTVPIAA
DQPGYVVISGPTGTRQYLARSSRGIPIPAGQLVRVSGLAGTVLLVEPLQQATAVEGRDAR
GESR
Download sequence
Identical sequences B9L3R2
gi|221635832|ref|YP_002523708.1| 309801.trd_A0426 WP_012642840.1.69661 gi|221635832|ref|YP_002523708.1|NC_011961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]