SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 309803.CTN_0693 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  309803.CTN_0693
Domain Number 1 Region: 126-344
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.28e-52
Family D-glucarate dehydratase-like 0.0000368
Further Details:      
 
Domain Number 2 Region: 5-126
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.38e-21
Family Enolase N-terminal domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 309803.CTN_0693
Sequence length 347
Comment (Thermotoga neapolitana DSM 4359)
Sequence
MSMSKIVDVKFTLRRHEYEKPFHITGSISSESRNVEVEITLESGIRGYGEASPSFRVNGE
RVEALLAVENVVKDMITGFDVRNYAKIFEITDKLFAFPSLKAAVQFAVLDALAQELDVQV
CHLLGGAKSRIETDKTVGIDSIEKRVEEARKIFEEGFRVIKIKVGENLKEDIEAMMEIAK
VTKGAKYIVDANMGYSPKEAVEFVKKIYQAGIDISVYEQPVRREDIDGLKFVRFHSPFPV
AADESARTKFDVMRLVKEEAVDYVNIKLMKSGISDALAIVKIAEASGLKLMIGCMGESSL
GINQSVHFALGTGAFEYHDLDSHLMLKEEKFRGKFIQEGPEMRVREE
Download sequence
Identical sequences B9K7D6
gi|222099667|ref|YP_002534235.1| 309803.CTN_0693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]