SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 309803.CTN_1710 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  309803.CTN_1710
Domain Number 1 Region: 77-145
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000000732
Family NfeD domain-like 0.0023
Further Details:      
 
Weak hits

Sequence:  309803.CTN_1710
Domain Number - Region: 27-80
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0222
Family Glycerol-3-phosphate transporter 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 309803.CTN_1710
Sequence length 145
Comment (Thermotoga neapolitana DSM 4359)
Sequence
MRGDNMEAWVFWLVLGVILMVAEILTPTFFIFWFGVGALAASLVSLYLGVYIQIIVFAVV
SIVLVLFTRRLVQSWESPRKIHVEEIVGKVALVIETINNKEGTGLVKINGDVWRAFAEDD
EEVIEKGEHVKILKVEGAHVVVKKV
Download sequence
Identical sequences B9KAA3
309803.CTN_1710 gi|222100684|ref|YP_002535252.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]