SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 309807.SRU_2230 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  309807.SRU_2230
Domain Number - Region: 91-150
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00418
Family NfeD domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 309807.SRU_2230
Sequence length 198
Comment (Salinibacter ruber DSM 13855)
Sequence
MDLDPTLLTWAFVVGGALLMLIEAVVPGGIAFFLGIGGVVVGGLRALGLLVDPLSSVVTW
VFLSTGLTIALRPLMLRFVQGDVSLAMTDEDAEAMGETVTVVEAVGPESPGRIRFRGATW
DARTLEGRLPDGAEAQLLYRDNLTWVVEPADHADLDAELSAAIGSDVSEGDANRSPSTDD
TTSDDSGLGYDPSARSSS
Download sequence
Identical sequences D5HBH4 Q2S0E6
GO.3497 gi|294508273|ref|YP_003572331.1| WP_011404956.1.91540 YP_446335.1.20240 gi|83815735|ref|YP_446335.1| 309807.SRU_2230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]