SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 309807.SRU_2470 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  309807.SRU_2470
Domain Number 1 Region: 19-138
Classification Level Classification E-value
Superfamily SpoIIaa-like 8.63e-29
Family Sfri0576-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 309807.SRU_2470
Sequence length 164
Comment (Salinibacter ruber DSM 13855)
Sequence
MCHVGPARPDPSSTDHSRLRPPMHDFLDLPDPNLVGITLSDTLTEDDYEAFTSALEDQFA
AHITTRVLLVMEDVDDWAPEERWEDLAFDVRHLSDVDKVAIVSDDPWERWLEKTEALFPM
STIQTYDAADQEEALDWIRGDMDVPGVGPGSSSDPEASFADQDE
Download sequence
Identical sequences Q2RZR2
309807.SRU_2470 YP_446569.1.20240 gi|83814820|ref|YP_446569.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]