SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000001434 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000001434
Domain Number 1 Region: 73-266
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000000263
Family Voltage-gated potassium channels 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000001434
Sequence length 284
Comment (Takifugu rubripes)
Sequence
QAVVFIEDAIQYRSINHRVDVRSLRLYRCYYSTLCQWCLGLTIAVVLLLAFVERPSSLSL
SSDPRRSTHLNPPCGATESVELVCLVVFALDLAVKSYLIGWDEFRKNKWLIGYLVVISVS
VIDWMLSVSMMCDERLRVRRLLRPFFLLQNSSLMKKTLKCIKRTLPEIASVILLLALHLC
LFTMIGMLLFAKTEDPEKNEEWNLHFRNLPTALTSLLVLLTTANNPDVMLPAYSLNRSYA
IFFMAFSVIGTYCLMNLLTAIIYNQFRGYLLMSVQTSIIRRRLG
Download sequence
Identical sequences H2RMS1
ENSTRUP00000001434 ENSTRUP00000001434 31033.ENSTRUP00000001434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]