SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000001502 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000001502
Domain Number 1 Region: 872-1228
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.78e-91
Family Reverse transcriptase 0.00031
Further Details:      
 
Domain Number 2 Region: 511-667
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.77e-40
Family Retroviral integrase, catalytic domain 0.003
Further Details:      
 
Domain Number 3 Region: 61-155
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0000000000000211
Family SCAN domain 0.0059
Further Details:      
 
Weak hits

Sequence:  31033.ENSTRUP00000001502
Domain Number - Region: 191-219
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00146
Family Retrovirus zinc finger-like domains 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000001502
Sequence length 1241
Comment (Takifugu rubripes)
Sequence
EVRIHFSAFERIASALKWPRDMWPVLLQCKLVGKAQEVVSALSLEDSLQYDVVKEAILRA
YELVPEAYRQKFWSHRKSAGQTFVEFAREKGNLFDKWSAANGIRNDFELLRQLVLLEDFK
GSLPEKVVMFLNEQKVSTLSRAAVLADEFVLTHKNVFSSPLRSDRFSASRATSAEPSLPP
LEKARGPPLSQPGSRECGYCHKRGHVIADCLSLKRKQQAPAAAQQRNVCLVKRVRKRTTE
RANARRMTDRKEITLLRDSAGSQLIIKANILPLSSATSCHSSVKIRGVGMVNMLVPLHRI
HLQCPLLSGWFEVAVLPDLPVPGVDFLLCNDIAGGQVSPTPIVVDVPVVINASTTESQIG
HQHAASLSTKAMELPATREEFIKAQQNDETLQNCLSSVLGVEQEKGQKVVYFMDRGLLVR
CWRQDASGDGDWSTAYQVVVPTAYRPQVLSLAHDNLWAGHLGITKTYDKILRHFFWPGLK
ADVVRHCRPCHVCQVTGKPNQVVPPAPLCPIPMMGEPFERVMVDCVGPLPKTKSGNQFLL
TIMCASTRFPEAIPLRRVTAPVISKALVKFFTVFGLPTVVQTDQGTNFMSRVFAQVLKSL
GIKHITSSPYHPESQGALERFHQTMKTMLKKCCFESQKDWDDAVPFVLFAAREAVQESLG
FSPAELVFRHEVRGPLKLLKEQFLLPRGGEGCSIPEYVLRLRERLQRACTLAKSSLASSQ
KKMKRRYDQKAVPPSFQPGDRVLILSPVPGSALSAKFSGPYVVEKKVNDTNFIIQTLDRR
RRNRLCHVNMMKPYYSPGKDGGSDPVSTTSDVGLPVSSVDTVSCPEEDGLVMRGATPPGV
RLKNSELLSDLSHFLSHLSSDHSNDIRELISDFSSLFNDIPTQTTAITHDIVLTNSRPIK
QRAYRVSPLKRECMRKEVDYLLQHGFAVPSSSSWSSSDAHPLPLIDDCIDEIGPARYVSK
LDLLKGYCQVPLTPRASEISAFVTQDSLYSDDWTSHMATLRNVFARLASASLTLNLPKCE
FGRGSVLYLGQQVGGGQVRPADLKIAAITAFPAPTTRRELRRFLGMAGFYRRFCKTFSIV
AAPLTALTSPQKPFAWSRECQQSFEDLKSLLSCNPVVSAPNFSLPFKLEVDASAVGAGAV
LLQEDPQGVDHPVAYSRKFDKHQLRYSTIEKETLALLYALQHFEVYLVSSVFTDHNPLVF
LSRIYNNNHRLMRWSLIAQNYNLEIKHRGSENILADALSRA
Download sequence
Identical sequences H2RMY9
31033.ENSTRUP00000001502 ENSTRUP00000001502 ENSTRUP00000001502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]