SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000002268 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000002268
Domain Number 1 Region: 37-323
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.97e-127
Family Enolase 0.000000000692
Further Details:      
 
Domain Number 2 Region: 1-34
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 0.000000207
Family Enolase N-terminal domain-like 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000002268
Sequence length 327
Comment (Takifugu rubripes)
Sequence
FGANAILGVSLAVCKAGAAEKGPLYRHIADLAGHKDVILPVPAFNVIGGSHAGNKLAMQE
FMILPVGAANFHEAMRIGAEVYHNLKNVIKAKYGKDATNVGDEGGFAPNILENNEALELL
KSAIAKAGYPDKIIIGMDVAASEFYRSGKYDLDFKSPDDPSRHISGEKLGDLYRSFIKNY
PVQSIEDPFDQDDWQNWAAFTASTEIQIVGDDLTVTNPKRIQQAVDKKACNCLLLKVNQI
GSVTESIKACKLAQSSGWGVMVSHRSGETEDTFISDLVVGLCTGQIKTGAPCRSERLAKY
NQLMRIEEELGDKAKFAGKDFRHPKIN
Download sequence
Identical sequences H2RQ53
31033.ENSTRUP00000002268 ENSTRUP00000002268 ENSTRUP00000002268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]