SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000002301 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000002301
Domain Number 1 Region: 115-135
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000147
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000002301
Sequence length 433
Comment (Takifugu rubripes)
Sequence
EQVNTLVETGITVGGQFVQVTPLTQPAARITLSNMPPFISDEFLVRELSRHGKVVSPIRK
MLSGCKSPLLRHVVSHRRQVHMILNNKADEFNYRFIVRVDDFDYTLFASALFASALKCFN
CREEGHLARACPSRVAPDTPAAEPATPAPAGPVAPQPVPAARRRWLSAEESSAAPDGAVA
ELRGGGSGTSVSGGSEIVEMVVEMNGESGVMGETEKMGEAGETGDTIQTGKLGGVSQVMG
EFGVPGIAAGELGEEAVSTGELGEEAVSTGERGEGAVSTVSTGEGAVSAGEGVVSAGESA
SGVSEWWLVPAKRRNKRKCAMKDKGDSKTGRLEDATAGTDTSDCESMSDCSSLSDTMPDR
HESNLYPPSMLSNFLRQTKGMKGLNLEKHFPDMLLFVHSASHLIKHRGTSDLTNPEIFRL
KKHMGKARKQLNI
Download sequence
Identical sequences H2RQ86
31033.ENSTRUP00000002301 ENSTRUP00000002301 ENSTRUP00000002301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]