SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000003078 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31033.ENSTRUP00000003078
Domain Number - Region: 106-134
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0314
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000003078
Sequence length 575
Comment (Takifugu rubripes)
Sequence
MTEQTTTSSEGIVGLDEPKKMTREDWRKKKELEEQRKLGNAPAEVDEEGKDINPHIPQYI
SSVPWYIDPSKRPTLKHQRPQDERQKQFNAIGEWYKRGVQDNSLATKFRKGACENCGAMT
HKKKDCLERPRKVGARFTGTSIAPDEHFQVELDLDYDGKRDRWNGYDPEEHQRIVEEYAK
VDLAKRTLKAHRLQDELASGKLDQTVNLRLKEELEREHNSEDEDEDKYADDIDMPGQNFD
SKRRITVRNLRIREDTAKYLRNLDPNSAYYDPKTRSMRENPYSNAGKNPDEVGYAGDNFV
RYTGDTITMAQTQLFAWEAYERGSEVHLQADPTKLELLHNSFKVKKEDFKEKQGDSILKK
YGGEEHLNAPPRELLLAQTEDYVEYSRHGAVLKGLEKAVARSKYEEDVLINNHACIWGSY
WKDGYWGYKCCHSMVKQSYCTGETGVGINNSDCVPFEESLTEPQEEEVPKSLLEMHRDKM
VKEKKKKKNKKNKNKKHTSDSSDSESEEKKKEKLKKALEAEDKRVKQVDALLQLDERKRP
YNSLGQVKAPSEEEMEAFRMKRCRPDDPMASFLGQ
Download sequence
Identical sequences H2RSG2
31033.ENSTRUP00000003078 ENSTRUP00000003078 ENSTRUP00000003078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]