SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000007005 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000007005
Domain Number 1 Region: 526-557,696-774
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000581
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000007005
Sequence length 775
Comment (Takifugu rubripes)
Sequence
TMAQRKRMAYNVSRDILDEETLDEIAEKADSNPSLCDKLKKSLRSSGPKAKKRLLGTLPI
ISWLPRYPFKENALGDLISGISVGIMQLPQGMAYALLASVPPVFGLYISIQIYFENILNR
WDITAFLLPGTYAVMSVMIGSVTERLAPESDFMTFDNMSNSSIVDLVSRDAARVRVAAAV
TCLSGLFQVLLGLLQLGFLVTYLSEPLVRGYTTGAAIHVIVSQLKYTFGINPKRHNGPMS
LIYTVLEVCYLVPKTNIGTLVVSIVAIICLILTKELNAYLSKKIPVPIPVELLGIVIATV
ISWQVNLNEQFGVDVVGKIPTGLQAPVVPDFSLFSQVIGDAFALAFVGYGIAISLGRIFA
LKYGYNVDSNQEFIALGLSNSIGGFFQCFAISCSMSRTMVQESTGGKTQVAGALSAIVIL
FITLWIGVLFQDLPKAVLAAIIYVNLHGMMKQFLDIPALWRTNKIDMVVWVVTFILTVLL
NPDLGLLASLVFSLLTVIFRTQLPQYSRLGQIPNTDIYKPVEDYNQVREVPGIFIFRSSA
TLYYANAEMYQEALEKKPSCSSSSSVLIVLGQIERRGRYKKPTTKDTERSNVRTSQQPVR
SFLTKRALWSLKRESVKQMAKKWFGDSNCVKLHQIFIFPEKGREIIGKSRTLGDQPALVT
LFPCQHVEYETGCICIFKVEETAKEDIAVIPMDYMPDPSLPRAIILDLSAVNFLDTVGVK
TLRRIQSEYGQIGIEVFLACCQTGVVDNLKSGGFFNDKVTKSCLFSTVHDAVLHC
Download sequence
Identical sequences H2S3N3
ENSTRUP00000007005 ENSTRUP00000007005 31033.ENSTRUP00000007005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]