SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000007333 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000007333
Domain Number 1 Region: 242-287
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000291
Family Retrovirus zinc finger-like domains 0.0011
Further Details:      
 
Domain Number 2 Region: 287-327
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000779
Family Retrovirus zinc finger-like domains 0.0035
Further Details:      
 
Weak hits

Sequence:  31033.ENSTRUP00000007333
Domain Number - Region: 352-372
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00279
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000007333
Sequence length 507
Comment (Takifugu rubripes)
Sequence
MYSPYHVGEDLEDAIYQEDEGDSEASEINSELEFRLYSQLHYSSNAGDMGELVDTVQEAE
GQVLQQLEATSEPADGDKEVIVIDSSPEVISVSDDNDSSDDTGVCNLKQHRSQRRQTSTP
SQQETQKSIRALGTPLSVDSSSLDSDSGDSGSNLGSSDSSDLSDSDDSDDLENWMILGRG
NQDGDQSISLNLEDEAVINTYSVFFGGDPEDWLVSNKDKEAQIYNRERDTRAIVPQLSHR
YYTSKNVQCRNCNKYGHLSKNCPEPKKMMACFLCGIQGHLASQCPNKHCNNCGLPGHLYD
SCTERAYWHKQCHRCSMTGHFFDVCPEIWRQYHITIKAGVPVKQQEKEKLQTSVYCYNCA
RKGHHGYMCTKQKMYNGMYPNTPFINQYDTVEDMKRRRHRIKLKVRDLRMNGHFPASPQS
LSTQEPSKKKQKLNHHKNNSQSNNTPKHIFFNDKCKLKGPSYKTKTYKAQEGTSGVKPWQ
PKRPVPTSREMGSGNKGQNKKRFKKSK
Download sequence
Identical sequences H2S4L1
ENSTRUP00000007333 31033.ENSTRUP00000007333 ENSTRUP00000007333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]