SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000007484 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000007484
Domain Number 1 Region: 128-151
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000356
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 
Weak hits

Sequence:  31033.ENSTRUP00000007484
Domain Number - Region: 35-73
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00688
Family Canonical RBD 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000007484
Sequence length 188
Comment (Takifugu rubripes)
Sequence
LSYASRMNRGVVVFVKEERLVAELVGRGVTVNRAYLQVSPLAAPSTRVTVSGVPPFITNE
ALEQELQHFGKFASGLRTVGLGCRNDKLKHVHSLRRQCFMFLTCPSQTLDVSFRVRHGDG
QYMVYASSGSMRCFECGDVGHKRVACPHRPANEGARTGAPPSGGDVEVAAVVADAGGGPS
GQVEEQGG
Download sequence
Identical sequences H2S512
ENSTRUP00000007484 ENSTRUP00000007484 31033.ENSTRUP00000007484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]