SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000008268 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000008268
Domain Number 1 Region: 229-264
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000366
Family Retrovirus zinc finger-like domains 0.0055
Further Details:      
 
Domain Number 2 Region: 63-87
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000017
Family CCCH zinc finger 0.0045
Further Details:      
 
Domain Number 3 Region: 153-177
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000955
Family CCCH zinc finger 0.004
Further Details:      
 
Weak hits

Sequence:  31033.ENSTRUP00000008268
Domain Number - Region: 38-59
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000327
Family CCCH zinc finger 0.006
Further Details:      
 
Domain Number - Region: 90-118
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0314
Family CCCH zinc finger 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000008268
Sequence length 273
Comment (Takifugu rubripes)
Sequence
MQDILANVDHIKFDLEIAVQQQLGAQPLPFPGMDKSGSAVCEFFMRAACMKGAMCPFRHI
SGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESK
IKDCPWYDRGFCKHGNILFIPPFSGPDCRHRHTRRVICVNYLVGFCPEGRSCKFMHPRFE
LPMGASEQPPLPLQSQNQSKSASAMGRSSMSLIQLTNSSPGINNTQMMPTQQNNMSTNRG
PRPLDQVTCFKCGDRGHYANKCTKGHLAFLSGQ
Download sequence
Identical sequences H2S796
ENSTRUP00000008268 31033.ENSTRUP00000008268 ENSTRUP00000008268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]