SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000009241 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000009241
Domain Number 1 Region: 530-560,642-716
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000518
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000009241
Sequence length 733
Comment (Takifugu rubripes)
Sequence
MEEEDSESQLMYRIERPVYDEAFLRSQLLHHRLKSTTLWKRLLKHFQCSSEKAKATVLNF
LPILKWLPSYPVKQYLFSDVVSGLSTGVVQLPQGLAYAMLAAVPPVYGLYSSFYPVMLYM
FFGTSRHISIGTFAVISLMIGGVAMREAPDSMFYILDANGTNSSLILDKTARDTRRVQVA
VVLTTLVGLIQLAFGLLRFGFVAIYLTEPLIRGFTTAASIHVCVSQLKYLLGVRTRRFSG
PLSAIYSFTAVVGDITSTNVATVILGLVCLIVLYVIKDLNERFKKKLPIPIPGEMVIVIV
STGISYGLSLSSDYNVDVIGNIPTGLLPPTIPEFSLMPHLLADSFAVAIVGFSMGISLSK
IFALKHGYSVDGNQELIALGLCNFISSFFQTFAITCSMSRSLVQESTGGKTQIAGLLSSI
VVLLVIVAIGFVFQPLPQTALAAIIIVNLVGMFKQFKDISVLWRISKIELAIWLVAFVAS
VLLGLDYGLLVAITFALMTVIYRTQSPESAILGHIPGTGLHFDVEYEEAVEYEGIKIFHF
SSPIYFANSDLYVTTLKEKVIPPLVSLLTKSSLVTAVKINVTKQTRTITIWGWIRTGTGV
NPELLQLTEQSETSNTLSPNHILEENGNSQVEDALASDSGEGFGPVHSIILDWTLVCFID
SVGAKAIKQVIKEYAGVDINVVIAGCSRILLSQLDALEFFTGLVTEQTVFPTINDAVLRC
QILRIFQQASSPL
Download sequence
Identical sequences H2SA15
31033.ENSTRUP00000009241 ENSTRUP00000009241 ENSTRUP00000009241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]