SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000010569 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000010569
Domain Number 1 Region: 156-391
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.32e-68
Family Tandem AAA-ATPase domain 0.0000522
Further Details:      
 
Domain Number 2 Region: 331-559
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.66e-51
Family Tandem AAA-ATPase domain 0.00072
Further Details:      
 
Weak hits

Sequence:  31033.ENSTRUP00000010569
Domain Number - Region: 570-595
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000123
Family Retrovirus zinc finger-like domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000010569
Sequence length 614
Comment (Takifugu rubripes)
Sequence
METDNRSHKRSYEEDKSVSGGSEEDDDYVPYVPVKIRKQQMLQKMLHLRGKALDEDRKDS
GEEQRDEDEGLGPRSNVSLLDQHQHLKEKAEARKESAKEKQLKEEEKILESVAEGRALMS
VKEMAKGIIYDDPIKTSWKAPRYILNMPDTRHERVRKKFHILVDGDNIPAPIKSFREMKL
PPAILKGLKKKGIVHPTPIQIQGMPTVLSGRDMIGIAFTGSGKTLVFILPIIMFCLEQEK
RLPFCKREGPYGLIICPSRELARQTHGIIEYYCKLLEEEGAPQLRTALCIGGMSVKEQME
VIKHGVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMIDMGFEEDIRTIFSYFKGQ
RQTLLYSATMPKKIQNFAKSALVKPITINVGRAGAASLDVIQEVEYVKEEAKMVYLLECL
QKTSPPVLMFAEKKADVDAIHEYLLLKGVEAVAIHGGKDQEERTKAIEAFKEGKKDVLVA
TDVASKGLDFPAIQHVVNYDMPEEIENYVHRIGRTGRSGKTGIATTFINKGCDESVLMDL
KALLVEAKQKVPPVLQVLQTGDETMLDIGGERGCTFCGGLGHRITDCPKLEAMQTKQVSN
LGRKDYLAHSSMDF
Download sequence
Identical sequences H2SDT8
ENSTRUP00000010569 31033.ENSTRUP00000010569 XP_003970499.1.43653 ENSTRUP00000010569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]