SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000013871 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000013871
Domain Number 1 Region: 79-158
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.96e-23
Family Canonical RBD 0.0079
Further Details:      
 
Domain Number 2 Region: 4-79
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.84e-21
Family Canonical RBD 0.0073
Further Details:      
 
Domain Number 3 Region: 154-189
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000128
Family Retrovirus zinc finger-like domains 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000013871
Sequence length 568
Comment (Takifugu rubripes)
Sequence
MDKSNTVKIFVGNLALDTTQEELSAIFEPYGQVVSCSVLRQFAFVHLQGEGAAERAIREL
NGREFRGRNLVVEESRGRPLHSTKVFVGNLSGMCTTEDLQQLFQTFGKVLECDKVKGYAF
VHMETKEDALQAIEALHGTSFKGRPLSVELSKVQPSKQTPTGKIPCVNCGKQGHYAGECP
VGKPSLEQYQSQAAVLAAAAAAAAGLPLQVQQSVHNSVYNTSSFDPTYAALTGITAGTRT
DGNPMNPAVYGALASQVYGANVANQLYGSVANQAALTSGATQMYSSMTPNIYGQMAANPA
AAAAAAAAAAYSTPVYTPTVANTPVYLTAAPGIEMPTAAAAVNPTYTMAPAIYGAATPAY
AHISTMAAADHTAAIVEAARQAHYFAQGQQVVAEQQTVAAAAAAAAAAKSGERDRSPLRR
SVPLLPDPVMKPFMYQRAKPRRPLLPTPAGRSAEEAAEAAEDPMVRYYAEYYQQLQQYPQ
FQYTYAPASTVTAIPGMPGVPTVSAMPTMSAQPVTTLDALRPVVPAAAVAAAIAAPRVYE
PPLPPPTRKEAILRRPELSLHTPEPPFR
Download sequence
Identical sequences H2SN85
31033.ENSTRUP00000013871 XP_003978084.1.43653 ENSTRUP00000013871 ENSTRUP00000013871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]